SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_0775 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_0775
Domain Number 1 Region: 919-1128
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.12e-36
Family Clostridium neurotoxins, the second last domain 0.016
Further Details:      
 
Domain Number 2 Region: 57-187
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.00000000156
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_0775
Sequence length 1380
Comment (Methanocella paludicola SANAE)
Sequence
MIGLALISPSLAASYSPGIADNSANSSGNISIAQSTHPFLLFHDISQTPGYQHSSSSPWS
GWKSNIMSSANTALSKDFTDPSWGTSGTYDDGWISARGQYAMNLAFAYQITKDSKYSTKA
KEALLNLDIARKPSNTVYMSPEGFQAIGLYSYCLAYDWIQPTLDSSSDTLIRDKLARLAD
TVYTNLNSATVNPNYDYKNYIYYFDFMGQAYPDLGIAGVTLNDYTNPNHLSFSSTPADWI
KVGTDYFFVNDKLHNFNRSMISFGCDNSGQDLFGDYKTYYTDDLVLWAQVYSFYYGKNMF
DVYPIAKQALTSEIWNSLPNQYSSNFVTDGNIKYSYQRGIANLLDSDNRSYALNHDNIID
SSNLLPYSGSMSHIYYTSMLPSALLYTVYGDYSSTPMKFPPWTSRLDANSQLQVFRGSWN
TDSDWLSFTTWDVFAGANRDMAHNDQLSLEYYGHGDLLLADGGEDKNVLDAYYGQYEVHH
NTIAIEDPRTPFAPSSWADSTARGIFKGYYYLRTPAVINSLANTSWMEIADAKATINDVN
THESDGSSDSKTISSPIQYDRSILYPEKDYFIVVDRMEGSQAWCYRNIFRPTSLNIVPST
GISESQVGHVIGDLTVGNTSYNWLSQPYKVEKTTGVTTNSIKWNTTNPYGNKVNLQVFTV
PSSEVLVTKHVGRIAGYDVQSEVFSPVVYFRSPPTNNMYRATVLLPKYSSESQRSPQVLS
VSGTGNALTVTSPTYVDYIYTGKGVSSFASYSTDANTVFVRSSGQPVEYTLMGGRYLNYS
NVPLVTVSSMVDYLTLKKQGNGLTFSVKGTGNITITLSQINPVSGYTVTRDGTPYTNWAI
SGNTMTITTGSSEHRFDIVPSGTSTPTPTSTPTPSITPTPTATPTITPTATPTPTPTAMP
TITPTPKPSATPTPTPGSGIVKNGLTLWYDMNDTGGTLTDLSGNGNNGVANASTYAKLPS
GAGSRNFNGASSYIQCHDSPGLNPAANGMTIEVLFNPRNFTSTQSLASKGYSTNTGQGYN
MRLNSDKTLDFFMYNGNQNMAYVKCDPGLMAGKWYMATATYDGSTISLYVNGVKYTSTPC
TGTSPSAIDLTIGRYSPYAAWPFNGSIATVRIYDRGLTSQEITDNYNTDTWRTTTSPTPT
PTPTPTVAPTITPTATPTPTPTPKPSITPTPTPKPSITPTSTATPTATPTPKPSITPTPT
PKPSITPTSTATPTATPTPKPSITPTPTPKPSVTPTPIPRQLPGLAATYIGDSIPSTMVG
GRQYTVSIIMKNTGNVSWSTNGGIWLSADNTSDAAQFGSTHVNMAPGVTVAPGGTYTWRV
HIKAPNAAGSYTLKYRTAQGTYGTFGDTVSKNVVVYKPYGRSKLFDPGSWIDFINGLLNG
Download sequence
Identical sequences D1YWM5
304371.MCP_0775 gi|282163445|ref|YP_003355830.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]