SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_0839 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_0839
Domain Number 1 Region: 32-238
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-37
Family Clostridium neurotoxins, the second last domain 0.041
Further Details:      
 
Domain Number 2 Region: 270-404
Classification Level Classification E-value
Superfamily Chondroitin AC/alginate lyase 0.0000054
Family Hyaluronate lyase-like catalytic, N-terminal domain 0.044
Further Details:      
 
Weak hits

Sequence:  304371.MCP_0839
Domain Number - Region: 932-1065
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000659
Family Virulence factor P.69 pertactin 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_0839
Sequence length 1072
Comment (Methanocella paludicola SANAE)
Sequence
MKLLIKIVLYICPFLLLFTVCGIQAAFAGSLVSSGLMLWYDMNDTGSTLTDRSNNGNPGT
VYGALYDLLPSGAGEREFDGYNDHIKCNNSPGISPAGGLTVEVLFRPGRPGSLQTLVSKS
ASGATGDGYTMWINSNNDLQFLIYDRNHKKVVVSARPGFTKTNWYHATAVYNGANVTLYV
NGVKYSTAVCGGFSPSTMALTIGKYAPSSSLYFDGDIATVRIYDRALTASEVLSNYKADQ
WRVTTTTHPFLLFHDIANTPGYKYRSSQPWSGWEEGILDSANIALTKDFTDPTWATSWEA
DNWVSARGQYAMNLGLAYQITKDKKYADKAKQALLDLDVGEVPEEPNSMIPEEFKAMSLL
GYSLAYDWVQPALDIDSDKAIRDKLAVLADDVYGDLNWDGTKRSYITFCDFQGQAYPTLG
IAGVVLHDYVNPHKLALRSMPSDWVKAATTYYFVNDGLHDYGQSLLSFEVDDAGKDMMGA
YRAYYIDDLSWWAQVYSYYYQKNFLNTYPLAKKALTAELWSSLPNGYSGDLATDSNLIYA
YHSGIANLLDTQDRSYILKYDDLVKDSNLLPYSREASHIYYDTEMPDALYYLVALDYSKV
ARSSPPYSSHLDDDSVYQVIREGWTTDSDWLSLVTYEEDTPTYSWRSAAHHDQMSIEYYS
HGDLLLADAGEDRNILDRTYGRGESSHNTIAIENPRLPFTASSWANSNARGIFKGTRAGV
ETPVDINILAQTPWMVIADTDTAISEIISTFDTAQKLSSPINYERTVLYPDRDYMILVDR
LEGMETWTYRTIFRPSSLSITPTEDKNGDGLYSGSEVGHVNLDLAVGPGSYDWRSMAYKK
ENATGIKTSSVAWTTTNPYGQAVGMKLYSVPSSEIRVTKLVGRVAGPDVRSEVLVPVVYY
RSAPSKTLYRATVLLPAYADETKKVPQAITVSGNGNALQVKGQGHIDYIYTGKGASWFAS
YKTDADTVFIRARNGNATEITFLNGSYVSYAGAPIITLSGRADYFTFNKSGTSFSFKVRS
AGTVSVTVSKLDPKSGSYTVLKDGKTYTGWTKVDGQTLIITNSGGEHKYDIT
Download sequence
Identical sequences D1YWT9
gi|282163509|ref|YP_003355894.1| 304371.MCP_0839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]