SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_1120 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_1120
Domain Number 1 Region: 102-268
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.06e-57
Family NadC C-terminal domain-like 0.0000117
Further Details:      
 
Domain Number 2 Region: 5-101
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 5.18e-22
Family NadC N-terminal domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_1120
Sequence length 270
Comment (Methanocella paludicola SANAE)
Sequence
MLTAGELDAFFEEDLGDDDDSNGIVPAVEALGQIICKEEGVLAGLEEACAVFRHLGLSVG
SDLVDGQPVRKGDIILEARGSARDLMRGERLALNFLGRMSGIATLTAKCVGLAPGVRVAA
TRKTTPGFRKFEKKAVKLGGGDTHRYDLSSAVMIKDNQIRIMGLENAIREAKKVASFTKK
IEVEVESLEDAEKAARAGADIIMFDNMKPAMIKKGVKIVKSVDERILLEASGGITLSNIS
EYAKTGVDVISLGALTRDARWLDFSMDIQL
Download sequence
Identical sequences D1YXM0
304371.MCP_1120 gi|282163790|ref|YP_003356175.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]