SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_1733 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_1733
Domain Number 1 Region: 45-221
Classification Level Classification E-value
Superfamily Flavoproteins 3.29e-29
Family WrbA-like 0.076
Further Details:      
 
Domain Number 2 Region: 2-34
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.000000014
Family Rubredoxin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_1733
Sequence length 258
Comment (Methanocella paludicola SANAE)
Sequence
MAKWKCGVCGYEMDGDSPPDDCPSCGSFKDEFYEKGKRPKDRLDERPELLIINGSKHRAH
NTAYFATIAERAASEYGVSCKLLHLNDYNVEHCWCCYSMKEDMCRYPCRNAFDDVHKLHE
MIMGAKAIIVVSPINWNGIPSRLKAFLDRLTCIENMYLIDKSTPLAGRTVGIIVNGHEDG
AYKTAFDIFMVFQNLGYILAPYGIAYSTHGRAYQSETDHAYFKEDKLMEEYVKNVTHNVV
SFSRLGVESKMDIRPSCE
Download sequence
Identical sequences D1YZD3
gi|282164403|ref|YP_003356788.1| 304371.MCP_1733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]