SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_2201 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_2201
Domain Number 1 Region: 308-420
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 4.84e-24
Family Toll/Interleukin receptor TIR domain 0.0048
Further Details:      
 
Weak hits

Sequence:  304371.MCP_2201
Domain Number - Region: 84-222
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000333
Family Laminin G-like module 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_2201
Sequence length 447
Comment (Methanocella paludicola SANAE)
Sequence
MTAIGLKRILIITAIITIIFISSIALGMAEENLSQYYDKVLFSDEFEHGTSNWELTQAWR
VTTDGNNTYLVGEYTGDKAKTNWVIWNPDPLRLRLIKFDNYTFAADFKLDSGMISFNYRD
VNEPSYPPNRHYSVQVNRAGNYLTIDINKNGALTQPTYTQARVPGADGWHKIEITGRGTE
IQVQLDGKLVMTYVDEHNPYLAGGAAFEIPHGTLVAVDNIRLLGGADTTVTDQRYIIYLG
FLLVVIVIISIVFGLNYYLKKRRALKVSKVESKPTQEAQAPAIKAQMNGAMAIPDAQKAT
SEPGPRVVGHDVFISYSHDDKPTADAICAGLEAEGIKCWIAPRDVLPGAIFQEAIIDAID
SSSIMVVVYSSKSNNSPHVVRELSRAVSKDVIIIPFRIEDVPLSKTMEYLISVPHWLDAI
TPPVEMHISELVRVAKVNLDIKRKKSN
Download sequence
Identical sequences D1Z0Q1
304371.MCP_2201 gi|282164871|ref|YP_003357256.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]