SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 304371.MCP_2816 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  304371.MCP_2816
Domain Number 1 Region: 72-161
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.5e-22
Family HSP20 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 304371.MCP_2816
Sequence length 162
Comment (Methanocella paludicola SANAE)
Sequence
MARRRNPFDIFGDFDEMFEEMLKEFENMGPGEHESGPFFYGFSINQRPGEEPEIREFGNI
RPESGKIEIGERKPLVDVFDTDKTVQIVAEMPGIEKEDVELSAEGRELEIKASHGERKYH
EFVDLPADVDIDSAKASYKNGVLDITLNKIQRPSRKKRINVE
Download sequence
Identical sequences D1Z2G6
304371.MCP_2816 gi|282165486|ref|YP_003357871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]