SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI134189 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI134189
Domain Number 1 Region: 94-163
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 3.53e-20
Family F1F0 ATP synthase subunit C 0.0044
Further Details:      
 
Domain Number 2 Region: 21-85
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.00000301
Family F1F0 ATP synthase subunit C 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI134189
Sequence length 176
Comment (Chlamydomonas reinhardtii)
Sequence
MDHYRSLLQETAASNQDTAPFFGFIGAAAALVFSCMGAAYGTAKSGVGIASMGVMRPELV
MKSIVPVVMAGVLGIYGLIIAVIISTGVNPATYKLYDGFAHLASGLACGLAGLAAGMAIG
IVGDAGVRANAQQPKLFVGMILILIFAEALALYGLIVGIILSSKAGASAAAPPAAL
Download sequence
Identical sequences A8HXZ5
3055.JGI134189 XP_001696361.1.80978 jgi|Chlre4|134189|estExt_gwp_1W.C_30103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]