SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI136100 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI136100
Domain Number 1 Region: 306-471,512-653
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.29e-55
Family Tandem AAA-ATPase domain 0.00079
Further Details:      
 
Domain Number 2 Region: 96-263
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.65e-32
Family SPRY domain 0.01
Further Details:      
 
Domain Number 3 Region: 3-68
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.1e-17
Family Tandem AAA-ATPase domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI136100
Sequence length 772
Comment (Chlamydomonas reinhardtii)
Sequence
MSAFEELGVMPELAKAVEDLGWMLPSPVQAEAIPLILGGGDVMAAAETGSGKTGAFAIPM
LQIVHETLRQRARSGSAASTSGRGAAGAAAAAASPAAVPCVLSSEDRELHVAVSPDGLSA
QSRSEKAWGGVRGSVGVFASCGGKVYYEVTVTDEGLCRVGWSCPTAALELGTDRLGWGFG
GTGKKSHNRQFDSYGEPFALNDVVGCLLDCGEAGGSVAFTKNGRPLGEAFKLPDNLRNQV
LHPAITLKNAEVALNFGATPLAFPPPPGYIPLAQAPAAWVAAGGGAAAASAGGGGNGRGE
KDLGRKPVCLILEPAKDLAEQTANCFNDYGKHLKAPEVKTGLFVGGMDAAPQIRMLREGV
DVVVGTPGRVIDFVESGKIPLDQIRFFVLDEADRLIADNPDVITKLYGRLPKQGTGIHRL
QVLLFSATLHSPEVKDMAGRICINPILVDLKGRDAVPETVDHVLVRVDPREDRSWLQSNP
EVFTDSCHALDRVGPNAAASPECLSEGVKRLKQRLLQRIIDTMKMEQCLIFCRTNHDCDQ
LERFLNTLGGAGGGAGGRGFRGKRESGKENPYSCCVLAGARSMDERRAALSAFKDGDVRF
LIATDVAARGIDIRELPYVINMTLPDKSEDYIHRIGRVGRADTMGLAISLVAEVPEKVWF
CTVKGMKPWLAPDSSNTRTTDKGGHTIWYNERELLGAIEGRLGRPIPPMSDDLTLPPELA
ERLSAAGDKYGQQRGGGVSKEHLAAIASNVAQLAGLEWQVQTSYLSLKRKWG
Download sequence
Identical sequences A8IRS1
XP_001691858.1.80978 jgi|Chlre4|136100|estExt_gwp_1W.C_140262 3055.JGI136100

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]