SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI145706 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI145706
Domain Number 1 Region: 1180-1288
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000000109
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0015
Further Details:      
 
Weak hits

Sequence:  3055.JGI145706
Domain Number - Region: 1322-1363
Classification Level Classification E-value
Superfamily SRCR-like 0.000889
Family Scavenger receptor cysteine-rich (SRCR) domain 0.048
Further Details:      
 
Domain Number - Region: 716-787
Classification Level Classification E-value
Superfamily SRCR-like 0.00235
Family Scavenger receptor cysteine-rich (SRCR) domain 0.02
Further Details:      
 
Domain Number - Region: 1367-1428
Classification Level Classification E-value
Superfamily SRCR-like 0.00392
Family Scavenger receptor cysteine-rich (SRCR) domain 0.019
Further Details:      
 
Domain Number - Region: 365-427
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00981
Family Pan module (APPLE domain) 0.046
Further Details:      
 
Domain Number - Region: 863-989
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0665
Family Clostridium neurotoxins, the second last domain 0.045
Further Details:      
 
Domain Number - Region: 276-310
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0706
Family Hairpin loop containing domain 0.085
Further Details:      
 
Domain Number - Region: 537-616
Classification Level Classification E-value
Superfamily SRCR-like 0.0981
Family Scavenger receptor cysteine-rich (SRCR) domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI145706
Sequence length 2032
Comment (Chlamydomonas reinhardtii)
Sequence
MVTLPTIRCSWFDNIAAALACRAAGLAGGRQVATGSSSGSGSSGGGVGAELVDWAGAGDC
ASVTAVVCDKGGSPPPSPPLPSPPELDAPPPGEAPPDLGLLDLDIVVGWTYDGVDYELGY
DHTSVRGGLYGGNNLDNRTSWERVYWPRGSTPDATTYHVCVRWFTGSRSLQLDLELEVTV
AGALAYSETAVWGTWLTRNSQCTPDANGYIGSYSYTAAGSGSSSSVGGATGSSSGGPPAL
QFLVAWGESMEPVCLDTTYVAGRVLEVLGATDGPAASSVGSCLQACLNRQPRDCQFIVYD
GMLGTCYLKSDFLVTNATSEDAVSSDEYGESGHNPDTTVCITPPVVSQVLDDAGMPVVSS
RGNYVCTHGWDLRGRVLGVGDRFATQEDCAAACDLNAQCQYYVYDTSESSPCALLYDVLA
GHPKYKFSYDSEAAACVKALRPNAPRRLELPALSGLGMDLAALAGPDTDGSWPAISVRNT
GGGAIVVYAWLVSFDSGLGTGGGASSSGGGGSDPKLYDPITGIAAVPAVPLCAGDGSSGW
GDAQAARLCRDVGFAGGYVAAGGADSAVEALHLPGGAVTGLSCPDRGGSDVPLLQCRGVV
EEDRGCERVAAAFCTPAPPPPPQPPSPPPVVSPPPPPPPPQPPRPKSATRTARLSDLAQT
VLPYAHGVLGVSADLSAYAGGMPPLVSVDKPRGFVWAATSHGPVLPVCAAGGGSGGDGWN
DAAAALACRAAGFPGGRAGRAVVNLRKQLTAMITNVTCGGESNGIGDCSGVFVEYGRCLR
LASVECNWEPPPGLAPQSALFDAYEGVRTSSQGVTAWRDPRTQDQTQPLQLTMSGTCGYD
NSNSYSLIQISRTPTDYDFEAAFQVATRGNTSSSFLYDNQAGQAFGKLVMPASYDEWAMY
VFVRQPGGTAAAVYRSSQPRNGGVGTFPGGVELIASQSVPPPGVSVQPDNLVLGADWRDN
NTFVKGRLAVAAVYTTALDLGQLNDLYNLYAPRFGWARAPRRPAPPDHASGDAPPPWDEG
VGSVTISSPPPFPSGFFRPNWPIAILTRDTYVGCFDGDPRYPAATDPAGDSGGGAILPYC
LMYEVDNMTAQLCAEAARSGGFKAYGLADGTTCLAAFDPQPAAALLGVAPQGECSTRCGG
DQQQACGGDGSFDLFLVGSAGSSLPGTDPSSGLGSVSAAYLGVRLSGGFSSAAGRVEVQL
EAGGQWGTVCGLPAFGDVEAELVCRTLGFSTGIAVFQPAPRSAALILMSDVSCNVSIHAQ
FSECASSRGAAVDRTCTHTNDMGVRCFSTETRPLPEIATSMIPHTWSLDTQSWGGQLAED
DGSVGYVWSYVPSAAAWLPVCHPGAFDDTAATLACRQAGFGSDPPELSVALVDGPDGDPN
TGRVEVTIDGDGKPICFDNEMLEPTSPTVDLLCHTLGYRGGGRASRGPQELNATNLVGWL
CVPFASDVAREIDLAAFELGVKLRRPFSDTEGGCDGLGMQVCGVFEVPNRDRIWFARGGR
PVEDLPKLAPFFVAALPRWIDRVFGGPGCNDTSLGYGVSAFLQDKNGQVQFKSTRTCAEV
SSPPPPPPPPAPLAPALPPGAVPPPSPPEAEPPAGEPPAVDYFCTGCVEIVMTPREGTLG
QSPPMEMPPAAPPNDGLEPPPSPSRPPPPTPQTLYGNGWPIDPDFCRTAAAEISTVINRA
ANDFRAVWSQPFALAECDPNPYRPVLRVCGVLDFVPVQLEKLLQDEGQGPRTWLQPYLMP
YNPDTYDYSNSPDEELCLPRFRSLDTNEHIYDISVRMVSNDTFGMQCLGNASYDVSPPPP
SPPPPPPSPPPPPPPSPPPPPPPTCQICATLDYAAGNPRFAFLRPTHCAAYAAAVSSGIV
FTAAVQDGRAFPPPPASMSCFPIVPVSFNCSLPANRDFPFRPCVTARNATAFVLDKVVPD
TSRANSHCFYFRNNTPISPGGVCASAARLNGVLFRTNSTVRPRVRTVFVENGADRSARTA
LGLVWTNNDTVLNVAVPDWGVASVSNPAAPDPTRPRPYTPPALATAGTAGRH
Download sequence
Identical sequences A8ISR1
XP_001692262.1.80978 3055.JGI145706 jgi|Chlre4|145706|Chlre2_kg.scaffold_15000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]