SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI166883 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI166883
Domain Number 1 Region: 41-139
Classification Level Classification E-value
Superfamily POZ domain 5.89e-21
Family Tetramerization domain of potassium channels 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI166883
Sequence length 213
Comment (Chlamydomonas reinhardtii)
Sequence
DFEDPLSIAVDGDGNIFVLDRAADDDDDENIDCCIKSPPDATSDLTLHVGGRKFAVHRAI
LAARCDYFRQRLAADTFADGAAAELELPDADADAFALLLRWLYTGAVELPAAAGQLQFIA
ELADRLLLPDLSAAATHKLLAAVTPATVVDAMLWAERQGEAGAALLAQLKEWYLEHDEQV
VATARDSLKRLAVASPDLMVELHVAKKKRPRAA
Download sequence
Identical sequences A8I4T4
jgi|Chlre4|166883|fgenesh2_pg.C_scaffold_5000352 XP_001700012.1.80978 3055.JGI166883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]