SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI186421 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI186421
Domain Number 1 Region: 7-74
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.79e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI186421
Sequence length 270
Comment (Chlamydomonas reinhardtii)
Sequence
MRTQNSVMECPRSMVGRVIGKSGETVKALQTYTGATIQIDQSVDPTRVSISGAAYSVNLA
VSIITDIIRGSFKGFALLRQATRPANGRNGYPAFTEPRPVYAPGYGLIPASQLYDDRTAP
PPMGTPYGLRPADSLQHVYPLMTTSLPTQSVLTLPSDAALAQQGTTMSLVNAQLQQLAMP
AGDISGLSGAGGGMQYGEAAYMPVLPMGAGGGHGGQGGAGLQMSQMGQMGQMSQMGQMGT
SEDFAMSASHRLIQAAGGGRGPMRPKNWLG
Download sequence
Identical sequences A8I9W8
jgi|Chlre4|186421|estExt_fgenesh2_pg.C_70027 XP_001701829.1.80978 3055.JGI186421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]