SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI189076 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI189076
Domain Number 1 Region: 1528-1648
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000131
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 
Weak hits

Sequence:  3055.JGI189076
Domain Number - Region: 360-432
Classification Level Classification E-value
Superfamily PapD-like 0.000218
Family MSP-like 0.032
Further Details:      
 
Domain Number - Region: 829-885
Classification Level Classification E-value
Superfamily PapD-like 0.00034
Family MSP-like 0.025
Further Details:      
 
Domain Number - Region: 1652-1729
Classification Level Classification E-value
Superfamily PapD-like 0.00262
Family MSP-like 0.023
Further Details:      
 
Domain Number - Region: 714-797
Classification Level Classification E-value
Superfamily PapD-like 0.00392
Family MSP-like 0.048
Further Details:      
 
Domain Number - Region: 258-293
Classification Level Classification E-value
Superfamily PapD-like 0.0161
Family MSP-like 0.032
Further Details:      
 
Domain Number - Region: 93-143
Classification Level Classification E-value
Superfamily PapD-like 0.0611
Family MSP-like 0.017
Further Details:      
 
Domain Number - Region: 2306-2374
Classification Level Classification E-value
Superfamily PapD-like 0.0841
Family Pilus chaperone 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI189076
Sequence length 2832
Comment (Chlamydomonas reinhardtii)
Sequence
MAQLQVTPAQLEFANVQPGQVLSAWVTVKNLDARARTVKVRPPKTKYFALREFFKPHSLA
GGLETRFEIKASTPKADVRIVGDLNMGLLPAESKATKRFQLVNQGAATAAFKIDYDRALP
ISITPTAGALEPGGEGQDVAVTITVGEPGSVAGEVTVAVAGEPPKKVMLTATVVRQSFDL
VDSTGAVTSELDFGSLYYGQAMEREVTLFNNGPVEARYVISYGTLAEMRSKVDDDAAANA
DPTDPYADVIMAARQRQKARSTGDNPFHVTPLSGVVPPYSKASVSVRYTPTQPAAVKGFN
SLMPTSDQAMRTYEYFAVVELLGMPGKLKLPIRARGMPGGLRMSPPNMFFGDVPTYAWAD
QLLTITNTNTLMPARYQMVKSTPYFAVEPSSGTVLPGGNVQVLVRYQPKAMGKHKGAIPI
KVMSEAGQLIQEMTLELGGSSLRVGDKVAPVGGTDKLPEDFTKPRHFVDDEQAMLSTLQA
HQKTNRLLAKPWEKPDLADTFADASNKNTLSRGEAEAMAAHRDKYTAAMRTQRTAREYQK
KNGRVAEDDVNLGMDTRSGLAAPEPKLSRTVDPLWRVDSTKEAAPRMLRQLGPADLEGTH
QWKARPQSEQERIDVTRELTKEELSRLVVGPRVVDFGKVSMGSTNTRHLVVHNTLDTSLN
VVLDLKPLEMLRESPSISQASEIRSVNEKIEYVVNGNHVLSFPLSADIVPVNLDFSAEDL
NFQFSLDNWDEAVEKLLILDNPHKFPVSFTVESTNPTFQISSGGGGVIRSQSSVEVVVRW
APDMLGPPKQEGHLIIKMVGGEAPKRIYMSGDLPEGNVRPKDKELVAPVAPVGTQQSVMM
QIKNHGSRDTAFRFHANDVLTIKPSGGRIGTEETLDIEVFFIAHDPGVLASTLVLEMRGG
NVVRIPFRAEAVVPHVEVLQDEFVFNQVFVGSSSRLPLTLHNTSPVSATLMCDLVQHPEF
QLLCPKDAWSTDEYEACPLEAIGATGQQVLGSRFGSARGSRQGSRRQSSSLGFRGMSNEG
YKYKITINPGKELPLLLNFRPAEQKHSDVELAFTLVTAGGYNVPPVRRVVTGSGETPRVI
LSKTLVDFGTKIVIRSNQIKAPYSLDLYITNQEEEPVTVAFGEPVVAPHAAACPVKGIFS
MDLAPLAPLQVGGQEMTTFQLRFCPRDARTYEALIPVYLDGDMDEPYLNIEVQGVGQYPR
LAFDVRECLLPPVPLGLRSTTTFYVLNNGYDNLELKYKLPADEGHLPMEVEFPEGTIIGL
AKDRLPVVVSFMSPKPMSFTANIDFMDEDGKRFSMPVTGTTDNSLMTHHAFHQLNKSHLV
FSHEVGMPVFLEEAAYELPPPSMCLGPSWPCRGVARYLNATTTRGPFDDLAKQMLGSRGK
LLVEVVEMLSGKNLPGKVFKLSNNRKEAVKQLLGQYDAVLVFLKSHGCLLNAVKPEMLLE
FDDFCRVMNERSTAATDNHDELEALEMWAEVESNFDLVSGQAWNATIMQIFKVFVLGRVT
LKSLRALPGLEGCELPPDSSIIGSNYYSVSESSLLAWMSAHCLREFGPKQRLTERARVVV
RIYVRPADLSDASVLFALLSGYWPGLDKKKKMLRLDCRDEQDKRENAEMVLKIMTDLGLP
YEITVDDIVLPNPQDMMVFVLYLHHTLPQFVPRAAVDFACKLGETQCKELELTNPSKKAI
SYSARLEGHRDFSIESSSIRIEPKASAKLLIRCTPTNTLSQAARLVLMSKREGGVHAATL
VFALQCKVNTRAPLKRVRTEGPLYDMQQFEFTVTNPFPADGDFTIQILHEPAEPLPKKEE
DPAATKNAKGNKSTNRRTGRKSTGLDATLGHEDPASKLGRVWPDAFGLDRNRLRLKQNAS
ERIKGFFLPFSMTTAYCTVLFRDKDQGEFCYELVGEPGLPAPIMEVKGNVPLEAPQQVYD
LMLPFPNSALEGAKRAFTEKHPLAKDKEQVALLKQDPFKGMEVMYERPTTRNPNALPPPE
PNTLRMHLNPIGTGIYPTRIMLTSPLDVRVVDLELTAQTMTQSFVLEFNTSARQAITQEI
PLVNTGDAQMTVTATINGSAWSGPREVSVSAGATVGYPLQFKPLMPGDVKGSLELAINAT
GERNTYTLVGRAAEPTAEGQIIIECQARKPAVKQFNVPNIVGTGTEYKVLCDLDFMVGVP
SIKVPPGMASQYKITACPQRSGTYNGTITFTTADGQFVWYTLEVRASEPPEVGTIDVRAT
VRTAAAVTVGVVNPLRKDMELAVRYSEVALCGPPSISLPGSQEPVPFEFFYAPLVPGTST
GSVVLVNDDVGEFRYLINMTADPAPPGDLPAMTAELGKSVSQPVVVENPLDTPVVLAASS
SNPRNFAITPAMVTLPAYGRVELAVEYTPSTLDHEEEATITVDGDVVGCWEYNVRGRGEL
PTIMEAISVSAMLGGQGQGVVQWRNPFPEPASETTVQPYGTLLVPLRYTPAALKTCHCEV
LVAVEGSSYSLNTLEWRFPVRALTEASLSGVVFKYKCKARARIEETMEVVLNGLQKVGPE
DEFTHEVVLPPEHRGFLEQALRVEPVVAAPVRLARPDAPLRYRVCFAPQRMLPPTSLELV
INKSTGGRWRFEMQLQATEPDLDGVLTIEAAVGATSYIPLRLYASGSEPQPFTASFPNDT
PMVFHVIPAKGLLPPAPKPGEPEPEPPLQVSYSCREFGKVVRGRLYVQTSDMQFSYELRG
RMPTYVPPTPAQFAPSVDNKLSAAAAEVQHPSVLGVGGPPESVTGAWGKQETVADGELVV
WGLPPLASRGRCTAAAAAMPGSFGAADSEPCVFAAGATTVAVAGSLPAMEQRRRNSNRAR
LDKRHGSPHTHV
Download sequence
Identical sequences A8IPW8
XP_001691575.1.80978 3055.JGI189076 jgi|Chlre4|189076|estExt_fgenesh2_pg.C_130156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]