SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI193146 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI193146
Domain Number 1 Region: 84-188
Classification Level Classification E-value
Superfamily POZ domain 4.12e-23
Family BTB/POZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI193146
Sequence length 240
Comment (Chlamydomonas reinhardtii)
Sequence
MVGVHAALRAALYDAWSASVYVSLGNAILRLVESQQCEVVHVAGNASAGESADGTGDVAR
LECRFQTQLASDNAGRLFFIDSALRIRKPDGTSDVAIRVGERRFCCHRAILCARCDYFQQ
RLAGGSFRDGLQGDIDLPDAEPEAFAQLLRWLYTGAADVPPEHARAVAELADRLLLPQLC
DVALEVLLASVSAEGVVEVLLWAAGAAESRGAGGCFGVLLGALKRWCVCHHGELSASVAR
Download sequence
Identical sequences A8J9C7
jgi|Chlre4|193146|estExt_fgenesh2_pg.C_390041 XP_001698217.1.80978 3055.JGI193146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]