SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI193279 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI193279
Domain Number 1 Region: 50-150
Classification Level Classification E-value
Superfamily POZ domain 6.28e-21
Family BTB/POZ domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI193279
Sequence length 225
Comment (Chlamydomonas reinhardtii)
Sequence
MDVSGAILLVDREDEQGRLARPAILPNGYLALGSHYGDTLLLLDMGLTPPDDTSDLVIRV
GERRFHCHRLILSTRCDYFKQRLAAGGGFADARAAELELPDADADAFALLLRWLYTGGAA
IPPALALAVAELADRLLLPELCLAAQGRLMSGVQPSTIATALLWADARAPASVRLRVELK
AWYVAHYTEVRRVAPEGIMRIMMASPALALELMDATHEAARQQHK
Download sequence
Identical sequences A8J9V6
XP_001698681.1.80978 jgi|Chlre4|193279|estExt_fgenesh2_pg.C_400082 3055.JGI193279

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]