SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI22211 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI22211
Domain Number 1 Region: 36-67
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000000144
Family CCCH zinc finger 0.0019
Further Details:      
 
Domain Number 2 Region: 133-168
Classification Level Classification E-value
Superfamily WW domain 0.000000049
Family WW domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI22211
Sequence length 177
Comment (Chlamydomonas reinhardtii)
Sequence
MDGAFPNRRGDGYGGSQGDGEGQGGKPRGFRGTAENAKTKVCTRWLQGDCRFGARCNFAH
GEHELRKLPERQGGRGGGGRGYGGNAGPYGGRGGYGGGGYGGQPGMPGGYGGGQGGAPGP
NVSEDVWAAQGYPVQGPNGWVQYRTRDTGEPYFHNHRTNETVWDRPADWPVTMQGQI
Download sequence
Identical sequences A8JIB8
jgi|Chlre4|22211|fgenesh1_pg.C_scaffold_94000028 3055.JGI22211 XP_001703693.1.80978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]