SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI282592 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI282592
Domain Number 1 Region: 114-230,267-306
Classification Level Classification E-value
Superfamily LigT-like 0.0000000445
Family 2'-5' RNA ligase LigT 0.012
Further Details:      
 
Domain Number 2 Region: 2-48
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000041
Family Eukaryotic type KH-domain (KH-domain type I) 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI282592
Sequence length 323
Comment (Chlamydomonas reinhardtii)
Sequence
MLIGKEGAKKKRLEAETGATLIIPRKTAAGPQGGGGGGDVTIRGPSKAVVASGYLRTELA
MAEAVAGRLLDYNYFLSLPLATPATVRQFEAFRKGVLGDPKVCPPGCGLEPSVFMAPQQL
HLTLVMLKLYSDQKRHAAQQALDRLRPRVGALLAGQPLKVHLQGLEYMNDDPSAMHVLYL
KVADMGPGGRLEALCDMVVEEFGRAGLLLPQDDRKVKLHATIINTRYRKRGAEQQQGGGG
GGSSSQQQRPQQGGRPSDRQPFDGRALLEQHGRLDLGIHTLQAVHLSQRGAYGEDGYYRC
VRQLPLQPLQAEAEAGAGAGADE
Download sequence
Identical sequences jgi|Chlre4|282592|au.g1131_t1 3055.JGI282592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]