SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI286944 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI286944
Domain Number - Region: 129-177
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.066
Family Trypanosoma sialidase, C-terminal domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI286944
Sequence length 1095
Comment (Chlamydomonas reinhardtii)
Sequence
MSPAESSDPAAPFTAVWIGRLADGVDSSAEQWLLGVGLGLGLGGSGDSGPPDGYSDGSDG
GGMAMSTSRLVTRTAADGYGIRESSVDSALRPPMGQWSMETSCLATAGAVAGAGTRQLAS
SPRRVGPEAFSVGGDFFYAAGTSPKYLTGHVAVVALYSRALSQVEVAQLAAVPGTITPAP
APSPSPTPGPSPSPSPGTITPAPAPSPSPIPSPSPSPGTITPAPAPSPSPTPGPSPSPSP
GTITPAPAPSPSPSPSPSPSPSPGTITPAPAPSPSPIPSPSPSPGTITPAPAPSPSPTPS
PSPSPAPSGSTSLLSSVPAELLSSDASSSSATLEASWDYVVPDPTATAAATGGTGSSFKT
TSYSLAASGLTGRSSLLAEQFPGATGVRVRSVVLLVPALRLPASLACSTQLGFGLRSTLL
AAVQQATGLAAGGSEGGAQGGVDVSVSCSSTAASAKLASASTATGLHHRRLLRLLAQAGT
SGTSASTGCEAAAGGNTALAVTLRLLSGAAGSSSDLGGGGSVTGSDLSQLVHSTLLTWRD
GGGSSTDGSSTPSALQQLCIPSPSIDSVRAEVRVTYAAYLSAQGRAVYSSACAGAASTTT
STSSLLPERAAALGLSGATSCAVLDTDGNLVAGSAASGAPGQQVLGTIDSGAAAGSAAAS
QPVGGAASAQAGQGMTGGSSSQGSSGGSSNAGAIAGGVIGALLGLTVVVVVAVLVVLRKR
KASEAAVTDLMMSHNPLAMFVAAPAKDPVESPGVELPQTAHQYQHQMQAQEHQDQGQDPV
DPPLKTMASAPTPSGASPPLSPSASIAAQVRKLLTVLHRSGSQLVEARSSQYRVHPQAAG
AGAGLAAAPGSGALTTSTSLQGPLGSLRLDEAWSQAAFPPAPASPSQSDPSEAPSPACRQ
RPSAGGSPPAGGAAAGFNSSLRRSRRVLSPDAAAVGEDLMPPPPLAPYTSGEVGAASRRR
PSRVCEEGDEGEQHEEQQQQQEGELPQEEEMPHAGVRSVRVTAEEVARLDGLRAAAAGVW
KGAAHDALLSPGLPNAGGPSDGGSTKSGADAAASALPLEANAGGLAGCGVARTARRTDSI
NLMAMPPGGSSTPRF
Download sequence
Identical sequences jgi|Chlre4|286944|au.g5215_t1 3055.JGI286944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]