SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI315942 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  3055.JGI315942
Domain Number - Region: 15-52
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 0.00392
Family beta-lactamase inhibitor protein-II, BLIP-II 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI315942
Sequence length 85
Comment (Chlamydomonas reinhardtii)
Sequence
MGDVGACGGDEGEIGNELPLVNLGPGVRTAAVVAGGYHTCALLVTDLARWGLPCQAWVKA
LAVVVVNAQRPWLLGTPLEFCYSLL
Download sequence
Identical sequences jgi|Chlre4|315942|kg.chromosome_13_#_87_#_KCC001198A_C01 3055.JGI315942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]