SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI379890 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI379890
Domain Number 1 Region: 46-126
Classification Level Classification E-value
Superfamily POZ domain 2.08e-17
Family BTB/POZ domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI379890
Sequence length 210
Comment (Chlamydomonas reinhardtii)
Sequence
MVRGTTALNRAAVAGGVTGAGKEGGSKKRKADTASSNGGSTGASSSRFPVHRAILAARCP
YFATHFASGLGDSNTRELHMPDTDPDALAALLRFVYGGELRVASREQASRCLALADRLLL
PKAAGLLRAHLLATLSPATVMADLTWAAGLAEGQGQAELLTGLVDYAAEQEADIAEEQVE
QLAAAQPALMAKLFTARVQAAKRCRVWKAC
Download sequence
Identical sequences jgi|Chlre4|379890|estExt_fgenesh1_pm.C_chromosome_110106 3055.JGI379890

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]