SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI391217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI391217
Domain Number 1 Region: 60-131
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 
Weak hits

Sequence:  3055.JGI391217
Domain Number - Region: 370-414
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0656
Family FAD/NAD-linked reductases, N-terminal and central domains 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI391217
Sequence length 523
Comment (Chlamydomonas reinhardtii)
Sequence
MLGPLAFDAHNAVAEKVLVGALAEYKTEPGIRSTVVLLKLLVTNAAAGLESVFMGVVSQW
KLVLPSVVCGFILGPGGQTVRAITQEADASISISAEPLQESGLPRERIATISGGLTQTVR
AVGLIVDKLLRRPAFEDALGVCEGVFPCTSMAANARTGFLRHPPGGSGSGGNSAALPSPA
AQQLLALSQQQEQLQQAQAAAEQQQQQQQQQQQQQQQQQQEQQQSFLLQPCQQRRHASCG
GGDNGSRSATAAMLFTAPPPAVGGGGGAAAAMRGGSGSGGVMSGRSDGGGATVLAPAGQQ
IQHGGGYFGGGSQQQYLDQPQQLQTQQPQQPQQPQQTAAADPTAAAFAAYVDSYDGATAA
AGVAAVGVAAGPGGLPAAAEEARQKLQVTLEVPENRVGVLIASSCNDWVAPSSALPLAAA
QQQAVQQQAVQAAVQQQAVQAAVQQQAVQQQAAVQQQAVAAAVQAAVAAVQVAVAAVALA
AVQQRAVEAEAEPPAAALLALLAEPTAAVLRLPLLPRQRSARD
Download sequence
Identical sequences jgi|Chlre4|391217|pasa_Sanger_mRNA32055 3055.JGI391217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]