SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI391727 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI391727
Domain Number 1 Region: 16-111
Classification Level Classification E-value
Superfamily POZ domain 0.000000628
Family BTB/POZ domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI391727
Sequence length 147
Comment (Chlamydomonas reinhardtii)
Sequence
MAASAIEKQPTGCITLLTADGHELLVDKEMLCSSSKFFAGMLTACDTTRLHVEESRDCME
PVLAAMRGSPPAATYDTRSTGCWAVYKKVLVVADKYDMSLVKERVEKWLVSRCLRGRMRS
PGFKFQEVAEGFEWLSICQKFDLKDLG
Download sequence
Identical sequences jgi|Chlre4|391727|pasa_Sanger_mRNA30516 3055.JGI391727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]