SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI398245 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI398245
Domain Number 1 Region: 51-177,214-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000923
Family Pentraxin (pentaxin) 0.082
Further Details:      
 
Domain Number 2 Region: 2-63
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000211
Family Pentraxin (pentaxin) 0.015
Further Details:      
 
Weak hits

Sequence:  3055.JGI398245
Domain Number - Region: 302-349
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0224
Family Pentraxin (pentaxin) 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI398245
Sequence length 363
Comment (Chlamydomonas reinhardtii)
Sequence
MLGGEQDCFGGCVDPSQGFHGLLDEIRLWRVALSQEEIVMRMRWATGLEGFPDLVAWWKF
DEPNADPGIFARHTVARDASGRGNDLQLETPPAPRPVEIQLPGAARPLRTGALEFRNGLA
LNKRLAPGGFPGRSFSLELWARGAAIAQHSTQLISYAAQRTDAGSGGGSGSGSSSPLPGG
FLDDAVRLERLMARSLTRPGRWGPTWVGGTAGAVALHVNSNEHTDDPGREAVLIFDAKWT
DDKWHHLAVTWQYDTGAAALYLDGEPRVAFFRSDYGVTEQRSPTEGGVAAVVAARTSRDG
SGALALGQILMLPNFRDFPSTAFTVEFWLWSVDRCRPGAVFSYAAGDYEQLDNALLIFDY
NSW
Download sequence
Identical sequences jgi|Chlre4|398245|pasa_Sanger_mRNA35131 3055.JGI398245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]