SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI417969 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI417969
Domain Number 1 Region: 37-329
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.33e-17
Family Glycosyl hydrolases family 16 0.037
Further Details:      
 
Weak hits

Sequence:  3055.JGI417969
Domain Number - Region: 331-436
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00095
Family Glycosyl hydrolases family 16 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI417969
Sequence length 437
Comment (Chlamydomonas reinhardtii)
Sequence
MRRFLLAAILAMWLSTTGVVGRKSPPSPTPSPLRSPPSPSPPPSANQVLIWSEEFSPCAA
GTPNCNNGLNTAIWQYDNGDGSQYTTNSITQWGNGQLQCNSDASENVRVESGVAGADGGV
LTINAVSKPVTCGITNSYGSSWTSGRLISRGAKPFMYSDPSTPIKIKARMRVPLRASSQP
LIALLPNTARTDCLGCGDFADGWCANGQMDLMNMMGGDGRVQQRIYSGGDNPIYWQGCST
LPATPVAASLASAGQAGGTSRWFTTSSIDSSQWYTGWASKAALPYAPYDRAFYMVLTLGI
CGYGGCTAPSDTSTMTMQVDWIRAYDMTPAFNGLDTDRWGFESGDGSQYGITQWGTFENT
CYFNTSKEVRAENIIDGGVSRSVLTINAWNTKASFACGTSRTTTRSARMLSRNKAAFRYL
DANTPLLIEARMRVPLG
Download sequence
Identical sequences 3055.JGI417969 jgi|Chlre4|417969|pasa_Sanger_mRNA22123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]