SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI425228 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI425228
Domain Number 1 Region: 140-244
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI425228
Sequence length 427
Comment (Chlamydomonas reinhardtii)
Sequence
MKEEPETAEQPAGEVAPSEGGKKKGKHRREKPWDHDGIDHWKVDAFKPEDNPNGLLEESS
FATLFPKYREKYLREVWPAVTKALKDMGIGCELNLVEGSMTVRTTRKTWDPYAIIKARDL
IKLLARSVPAPQALKILQDDMQCDIIKISGIIRNKEKFVKRRQRLIGPNGSTLKALELLT
GCYMLVQGNTVSAMGPYKGLKQLRRIVEDCIKNVHPIYHIKTLMIKRELAKDPALAEENW
DRFLPKFKKKNVKRKKPEAKPADEAGGKEAAKKVYTPFPPPMPPSKMDLQLESGEYFLSE
EQKRERARAAKDAAQEAKTAERKRQREAAFVAPKEDGPSTTGRGAGGGGKAAAAGGAGQG
EDVRALAESLKKKAKTSSAGGGKAEAGGRQAGAAVFLSPEVDMDGMGGGGKAAGKRKGEG
KGRREGK
Download sequence
Identical sequences A0A2K3D2R4
jgi|Chlre4|425228|pasa_Sanger_mRNA6968 3055.JGI425228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]