SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI425826 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI425826
Domain Number 1 Region: 24-197
Classification Level Classification E-value
Superfamily DNase I-like 5.89e-20
Family DNase I-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI425826
Sequence length 205
Comment (Chlamydomonas reinhardtii)
Sequence
MLARVLLWNSSERHGAYEFCALAVPSHRGDCMIARRRDSPLELLPQPPPAAVGPCLLLRL
RLGGQELTAACAHLAPFAENAPKRMQQIARIVAAAPSELPLLLAGDMNMREKETPAAGEV
GLMDAWVEAGSPPGQRWTWDTRTNKYYDGGHEYTARYDRILYRGCHVGGLRVTGNTPASD
DPHHFLSDHFALLATVTLPAPQPQQ
Download sequence
Identical sequences 3055.JGI425826 jgi|Chlre4|425826|pasa_Sanger_mRNA9016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]