SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 3055.JGI82 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3055.JGI82
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Histone-fold 8.83e-45
Family Nucleosome core histones 0.0000139
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 3055.JGI82
Sequence length 130
Comment (Chlamydomonas reinhardtii)
Sequence
MAGRGKGKTSGKKAVSRSAKAGLQFPVGRIARYLKKGKYAERIGAGAPVYLAAVLEYLTA
EVLELAGNAARDNKKNRIVPRHIQLAIRNDEELGKLLGEVTIASGGVLPNIHAVLLPKKT
KGGKGSEEAA
Download sequence
Identical sequences Q42680
3055.JGI100147 3055.JGI169653 3055.JGI295107 3055.JGI82 3055.JGI834 3055.JGI97737 3055.JGI97953 3055.JGI98017 3055.JGI99930 XP_001690809.1.80978 XP_001690827.1.80978 XP_001690995.1.80978 XP_001691003.1.80978 XP_001696444.1.80978 XP_001696453.1.80978 XP_001696461.1.80978 XP_001696521.1.80978 XP_001702225.1.80978 jgi|Chlre4|100147|e_gwH.11.195.1 jgi|Chlre4|169653|fgenesh2_pg.C_scaffold_11000092 jgi|Chlre4|295107|au.g12825_t1 jgi|Chlre4|82|fgenesh1_pm.C_scaffold_3000025 jgi|Chlre4|834|fgenesh1_pm.C_scaffold_741000004 jgi|Chlre4|97737|e_gwH.3.328.1 jgi|Chlre4|97953|e_gwH.3.321.1 jgi|Chlre4|98017|e_gwH.3.330.1 jgi|Chlre4|99930|e_gwH.11.396.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]