SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 306263.Cla_0303 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306263.Cla_0303
Domain Number 1 Region: 1-208
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 0.00000000000000366
Family Glycerophosphoryl diester phosphodiesterase 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 306263.Cla_0303
Sequence length 211
Comment (Campylobacter lari RM2100)
Sequence
MKIISHRGIWGKCSEKNTLKAFERSFCNDFGIETDLRDMLGQIVISHDMSNNSCLTLDNF
FALYQSFSNNFPLALNIKADGLQNVLKEFLEKYDVNNYFVFDMSVPDALLYIKAGFNVFT
RQSEYEKQPSFYNEVCGVWMDEFYEHWINEETIQEHLENNKKICIVSPELHKRDFKKEWQ
EYKEISKKLDSGDRLMLCTDYPFQAREFFNV
Download sequence
Identical sequences B9KF30
gi|222823342|ref|YP_002574916.1| WP_012661048.1.78799 306263.Cla_0303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]