SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 306263.Cla_0702 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306263.Cla_0702
Domain Number 1 Region: 10-107
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 2.49e-18
Family Multidomain sulfurtransferase (rhodanese) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 306263.Cla_0702
Sequence length 111
Comment (Campylobacter lari RM2100)
Sequence
MKNIAISKDILHEFCIVDVRTPSEWKSGVIKEAILIALCDDNGFMNENFIQEFKEKVDYQ
NKNIAFVCATGSRSKHTAMMIEDALGIECTNLDGGMVALLSQGYEVTKKGS
Download sequence
Identical sequences B9KG46
WP_012661414.1.78799 gi|222823708|ref|YP_002575282.1| 306263.Cla_0702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]