SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 306263.Cla_1518 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  306263.Cla_1518
Domain Number - Region: 99-162
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0383
Family Calponin-homology domain, CH-domain 0.012
Further Details:      
 
Domain Number - Region: 425-480
Classification Level Classification E-value
Superfamily Ribosome binding protein Y (YfiA homologue) 0.0419
Family Ribosome binding protein Y (YfiA homologue) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 306263.Cla_1518
Sequence length 560
Comment (Campylobacter lari RM2100)
Sequence
MSNIQASDALNLLSIAPQNENPSKESNNSNGDGEEFLNSLLQAIDEKDGSLSKDFKAPQK
ENKNESLKETINDKAQLDEKDALKLFEGANFMQILSLLEVLQSDSKDIKLNKLVQDNTAI
LALEKNLHKLKNIKNINELFNIAKELGLNIKNIKFEQIKDLKEAFPNLDKKGFFKAPNLN
NKDLIEPQKQNNTNVFQDLINQKITKLLKEEPNSSKNIKSKENEGVSLLSSALKNIELPK
KDIKAKENIQNVYFKEKFIEKIQDNKEIKDTKNIKNISKNDKLNDIELINLTQNLNLKKE
IKDKEKIDFKEVLKNEKLTTSEDSFGKKISSVLENSKELKAELTNTKNTQNLQNQNQDLK
INLENLLNPQEKQLKTEKNTQNTDIFSDIFKNTKELTKDDSDHNEENLNSYVKEMNRVSN
NFMKNQNIPMKETFNDFAQEFKDKLESYKAPITRFSITLNPHNLGEVEVTLVQRGSNLNI
SFNSNQNTLNLFIQHQAEFKNALVNMGFTNLEMNFSDQGRKEQNQQQKHKQNNNSKEDKV
NFEREIQEKPSLEMVLAKYF
Download sequence
Identical sequences B9KE34
306263.Cla_1518 WP_012662205.1.78799 gi|222824500|ref|YP_002576074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]