SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 306537.jk0603 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  306537.jk0603
Domain Number 1 Region: 119-280
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.28e-38
Family Tandem AAA-ATPase domain 0.093
Further Details:      
 
Domain Number 2 Region: 13-76
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000809
Family Eukaryotic type KH-domain (KH-domain type I) 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 306537.jk0603
Sequence length 331
Comment (Corynebacterium jeikeium K411)
Sequence
MTSPNSARSPRPRVASSTVELDPDSILAVAGPADENLRVLEHAFDADILTRGNRVTIRGE
ASEVSQARRVLQEMINLVSRGHAVDPAATKRAITLVEEQAPALVSSSDSAPIVSYRGKTV
RPKTPGQQEYVEAIDEDAIVFGIGPAGTGKTYLAMAKAVQALQAKDVNRIILTRPAVEAG
EKLGFLPGTLSDKIDPYLRPLHDALREMVDPETIPRLMDTGVIEVAPLAYMRGRTLNDSF
VVLDEAQNTTPAQMKMFLTRLGFGSKMVVTGDLSQVDLPNRQESGLKVARQVLQGVDGVS
IINLDSDDVVRHRLVSKIVEAYGTYELDNEI
Download sequence
Identical sequences Q4JWP5
WP_011273247.1.58937 306537.jk0603 gi|68535675|ref|YP_250380.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]