SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309798.COPRO5265_0823 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309798.COPRO5265_0823
Domain Number 1 Region: 326-475
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.4e-28
Family HD domain 0.017
Further Details:      
 
Domain Number 2 Region: 211-297
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000124
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309798.COPRO5265_0823
Sequence length 521
Comment (Coprothermobacter proteolyticus DSM 5265)
Sequence
MQLIIRIILGFVVGAAAGGLITYLYVTTSAKSKIQEMLDNAEKEASSIIKSAREEEKKAQ
ERSEALLKQAQEQVSSMLSEAGKELKSRREQLEKLEQRLSQREQQLDRRLDSVEAKERKA
EQKLQLAEEKLRSAEAFEQEAVKKLQEIAAMSTEEAKQFLFSRLEEELREEFGERIRRFE
ENFKEEADRKASEMIVAAMQRVIMEKPEDPVISVVELPSEEIKGRIIGREGRNIRTFERI
TGVDLIVDDTPEVVVLSSFDPVRREIARRTLEKLILDGRIQPARIEEIFTKEKEAIEQEI
IEAGDKAVRDLGIREMHPDLKHLVGQLKFRSSYGQNVLHHSIEVGFIAGMLASELHLDTQ
LAKRAGLLHDIGKALDHNVEGSHALIGAEVARKYRENPLVVNAIASHHNEVAQESIYAVI
TQVADAISASRPGARRENYAAYIKRVQQLEEIAKGFDGVESAFAIQAGREIRVIVHPEVI
GDNEAFALARDIAKKIEEELIYPGQIKVTVVRETRVAEYAK
Download sequence
Identical sequences B5Y8R5
gi|206896125|ref|YP_002247162.1| 309798.COPRO5265_0823 WP_012544472.1.90209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]