SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309799.DICTH_0058 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309799.DICTH_0058
Domain Number 1 Region: 21-334
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 1.05e-105
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000658
Further Details:      
 
Domain Number 2 Region: 333-483
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.28e-18
Family Glycosyl hydrolases family 32 C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 309799.DICTH_0058
Sequence length 485
Comment (Dictyoglomus thermophilum H 6 12)
Sequence
MKNSEILRYARYFVSNNRDKVNNKYRLKFHLMGECGWVNDPNGFIFFNGLYHCFFQYNPF
EPFWGPTYWGHAVSKDLVKWEHLPIALAPDEEYDKGGCFSGSAIEKDGKIYLMYTGHVEV
GSSEYYQTQCIAYSIDGVNFVKYRRNPVISTKDIPENASKRDFRDPKVFKRDDFYYVVIA
SQSQKGKGQILLYRSSDLFHWEYVNVILRNDNILEGDVWECPDLFRLGEKDVLLFSAQKK
EDSKIISSETFYCTGKMDFEKGLFDLYNCEKLDWGKYFYAPQTTIDQQERRLMIAWMDNW
NCPFPTQQEHNWAGAFILPRELFLRGDGLSIKPVREIEKYRKNGMIVEKFLSNDSIYLTF
DSECLETEVDLFFITPAQIEIELCSNLNASSNNSIKILYNNVSKKLQLIINDLVFSDERQ
EVKIDLKGDKLNLRFFLDKSSIEIFVNEGEKVLTNRVYPLEKYNTLKINSEGNCKVYLRK
WDLEV
Download sequence
Identical sequences B5YAX2
gi|206901362|ref|YP_002249945.1| 309799.DICTH_0058 WP_012548155.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]