SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309799.DICTH_1217 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309799.DICTH_1217
Domain Number 1 Region: 71-242
Classification Level Classification E-value
Superfamily alpha/beta knot 5.76e-44
Family YggJ C-terminal domain-like 0.00016
Further Details:      
 
Domain Number 2 Region: 13-66
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000323
Family YggJ N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309799.DICTH_1217
Sequence length 247
Comment (Dictyoglomus thermophilum H 6 12)
Sequence
MSPTFFATSFKEPDLLYIEDKEDIFHLVNVLRVREGEKINVNYNLKIYETYVERIEKDKI
VCRIIGELEDKESNVEVYLCQSLPKRESWEIILEKCTEIGVVGFIPLQTQRSIVNLSKDG
LVKKYERWNKIIREAVKQCGRNRLPLLYQVKSLEECLSLAREKDFDIVVAWEGAELGLKD
IMNRREIKDKIFLFIGPEGSFADEEIELMKKYGGIFFNMGPRILKVETAAIVASALLLYE
KGGLGLI
Download sequence
Identical sequences B5YET8
309799.DICTH_1217 gi|206900758|ref|YP_002251046.1| WP_012547551.1.10127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]