SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309801.trd_0114 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309801.trd_0114
Domain Number 1 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein S16 1.31e-33
Family Ribosomal protein S16 0.0000804
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_0114
Sequence length 99
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MIKLRLRRMGKKRQPHYRIVAAEARWPRDGRFIEVIGYYNPRTDPYTLEVNVERARWWLE
HGAQPTDTVRALLVRAGVLPPRQQNEAKRETAETAQPEA
Download sequence
Identical sequences B9KXC8
gi|221632149|ref|YP_002521370.1| WP_012641528.1.69661 309801.trd_0114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]