SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309801.trd_0437 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309801.trd_0437
Domain Number 1 Region: 54-244
Classification Level Classification E-value
Superfamily Pseudouridine synthase 4.52e-46
Family Pseudouridine synthase RsuA/RluD 0.00019
Further Details:      
 
Domain Number 2 Region: 4-74
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.000000000000013
Family Pseudouridine synthase RsuA N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_0437
Sequence length 282
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MSVTMTEQRLQRVLAAHGVASRRKAEELILAGRVTVDGVVVRELGRKVDPERQEICVDGK
PLHSEPRRYIVLHKPVGYITTTADEYGRKTVLDLVQVPERVVPVGRLDRDSSGLLLLTND
GDLIYRITHPRYELEKEYEVLVDGFPPPEVEEALRRGVPVDGRPVRIRRLEAIRVEPQGT
VYRVVIHEGRNRIIRRVFERVGYPVLRLQRVRVGPLRLGDLPPGRWRDLTASEVAALRRA
VGLPEFPEGAVGRERKARGGRGMPARRGDRRPSGVRKEHRRR
Download sequence
Identical sequences B9KY92
gi|221632463|ref|YP_002521684.1| WP_012641842.1.69661 309801.trd_0437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]