SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309801.trd_1895 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309801.trd_1895
Domain Number 1 Region: 145-235
Classification Level Classification E-value
Superfamily S13-like H2TH domain 1.44e-29
Family Middle domain of MutM-like DNA repair proteins 0.00094
Further Details:      
 
Domain Number 2 Region: 2-151
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 3.4e-28
Family N-terminal domain of MutM-like DNA repair proteins 0.00037
Further Details:      
 
Domain Number 3 Region: 234-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000399
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 309801.trd_1895
Sequence length 289
Comment (Thermomicrobium roseum DSM 5159)
Sequence
MPELPEVETIRRTLAPVLIGALVIGALRGEHPEDILLDPWPVFARRVRRHRIVALERRGK
YLAARFEDGDRLVIHLGMTGELRLSHPATAPGKHCHLALVLRSLRPLPPSLVDQRQRFLL
RYLDIRRFGRIALLDQAGWETFTARLGPEPLDPTLDPRALWSRLRERRTAIKAALLDQAL
LAGIGNIYADEALFQARLHPARRCQTLSLDEVERLLVALRTVLSAAIENAGTTIRDYRDG
QGRAGSFQSRLQVYGKPAGTPCPRCGTGLARIRIAGRSSVFCPRCQPLH
Download sequence
Identical sequences B9L1Z5
gi|221633868|ref|YP_002523094.1| WP_015922837.1.69661 309801.trd_1895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]