SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_0021 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_0021
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily L28p-like 4.32e-24
Family Ribosomal protein L28 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_0021
Sequence length 78
Comment (Salinibacter ruber DSM 13855)
Sequence
MARKDDVTGEGPVTGNSVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTIN
KKGIQAVLEEARKQGYDV
Download sequence
Identical sequences Q2S6K2
309807.SRU_0021 SrR1 WP_011402812.1.91540 YP_444179.1.20240 gi|83814500|ref|YP_444179.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]