SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_1773 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_1773
Domain Number 1 Region: 310-505
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.53e-48
Family Ribonuclease PH domain 1-like 0.0000192
Further Details:      
 
Domain Number 2 Region: 24-155
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.44e-43
Family Ribonuclease PH domain 1-like 0.0000424
Further Details:      
 
Domain Number 3 Region: 467-565
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 3.37e-28
Family Ribonuclease PH domain 2-like 0.0001
Further Details:      
 
Domain Number 4 Region: 149-239
Classification Level Classification E-value
Superfamily Ribonuclease PH domain 2-like 5.61e-25
Family Ribonuclease PH domain 2-like 0.00078
Further Details:      
 
Domain Number 5 Region: 628-712
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.11e-18
Family Cold shock DNA-binding domain-like 0.0013
Further Details:      
 
Domain Number 6 Region: 242-342
Classification Level Classification E-value
Superfamily Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0000000000000549
Family Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 3 0.0079
Further Details:      
 
Domain Number 7 Region: 569-648
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000253
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_1773
Sequence length 722
Comment (Salinibacter ruber DSM 13855)
Sequence
MTYESSRLRRMKPEAHIEDIEFVPDRSLSLETGRIAKQADGSVVARLGDTMVLSTATLSD
SVNESNFFPLTVDYREKFAAGGKVPGGFIKREGRPTDKETLTSRLIDRAIRPLFPDGFYH
DVHVVNFVISAGQDFDADVIAGVGSSAALMLSGAPFAGPFAEVRVGRVDGDYIVNPTMQQ
TEESDIDLVVAGKEDALVMVEGEAEEISEESMIEALDVAHRSIRRLCEGQHRLVEQAGEP
DPFEWEADRVPEQLVQRMREEYGPKVADHIHGPYSKETFHGGIGDLKDQAVDDVLGDASE
TPEGYTASDIRDAIGEVEKGEMRNMIVEEGKRIDGRDQTDVRDLWMEVGYLPRVHGSAIF
TRGETQVLGSITLGTSDDVQPVDEVFADTDKSFYLHYRFPPFSVGEASYLRGPKRREIGH
SMLAERALRPVIPEQDEFPYTIRINADVMESNGSSSMASVCAGSLALMDAGVPIEKPVAG
IAMGLVQEDDETTVLTDILGQEDHLGDMDFKLTGTRDGITACQMDMKIEGLSRDVMLKAL
KQSRDARHHILDRMEETIAEPRAELSSHAPRLTKLTIDPDRIGAVIGPGGKVVKSVQEET
NTEITVEEEEGVGIVTIAATNQRDAEAAIERIKQIVAVPEEGEDYVGTVKGIRDFGAFVE
IMPEKTGLLHVSEIDYDYVENVEDYLEVGDKVKVHLLEVHDDGKMRLTRKPFVSEENGEQ
NE
Download sequence
Identical sequences 309807.SRU_1773 YP_445890.1.20240 gi|83814865|ref|YP_445890.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]