SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 309807.SRU_1844 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  309807.SRU_1844
Domain Number 1 Region: 26-172
Classification Level Classification E-value
Superfamily OmpH-like 2.88e-27
Family OmpH-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 309807.SRU_1844
Sequence length 201
Comment (Salinibacter ruber DSM 13855)
Sequence
MAMSNRVTKSLSLLLLLVAMAAMPVQAQKIGYVDQQAVLVSMPEMQEVQQQVQQEMKQQQ
RELQQQRQQFQKRVKQFQQQQSLLDDSARAERERELQKRSQELRRAAQQRQQQMQKKRRK
MMQPLLEKLQGAIDKVAAQQELDMVLRRQVLLYEDETSERVADITRDVAGELGISLTQSP
GEPSPTLDQNAPPAGGSGSGQ
Download sequence
Identical sequences Q2S1H5
309807.SRU_1844 gi|83815252|ref|YP_445956.1| YP_445956.1.20240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]