SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000000639 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000000639
Domain Number 1 Region: 317-489,516-547
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.44e-21
Family Laminin G-like module 0.069
Further Details:      
 
Domain Number 2 Region: 134-247
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000006
Family Cadherin 0.0053
Further Details:      
 
Domain Number 3 Region: 25-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000457
Family Cadherin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000000639
Sequence length 957
Comment (Takifugu rubripes)
Sequence
FAIILSPLSAFSVLPGFLHLKKINKHKPWIETSYHGVITENMDTVLLDPPLVALDKDAPV
PYAGEICAFKIYGQDAPFEAVVLNRTSGEGVLRASSPVDCESQKEYTFIIQAYDCGAGPG
GADWKKSHKAVVHIQVNDVNEFSPVFREPLYKASLTEGKIYDSILQVEAWDQDCSPQYSQ
ICNYEIVTAGTPFAIDRNGNIRNTERLSFEKQQSYQITVTAFDCGQKRAKKDAAVHIDVK
PVCKPGWQGWNKRVDYEPGTGSRPLFPKMRLETCEGPLSGVKVLVELQTSHIGKGCDRET
YSEKSLQKLCGAASGSTDLLPAPSPSANWTASLLSDSGRDNDLIYRFAGRQAANVPDHVV
PQNLTDQFTVATWMKHGPSPGLRAEKETILCNSDKTEMNRHHYSLYVHNCRLVFLLRRDF
IQVDAFRPAEFHWKLEQICDKEWHYYVINVEFPAVTLFVDGVTYEPYLVTDDWPIHTSKI
DTQLTVGACWQAKKEKNPSKIWNEERKMSLIFHRLSCDHYFRGSLSGLTIRPGRIETQKV
ISCLQACKEGLDINSLEAWRRTLQFHFNPAQSVLVVEGEDVDSVNTAMTKVSYINSRQFP
TPGLRRLRITTSVQCFGEDSCLSIPDMKAVVMVLQPSEPRITIMGSNRLVRPAGDLRAPL
GVAPFKELHITSTIMKGDSFSGRECFPATVTPCCPSPDQRAGIMETMHNLDYCDVLVIGE
ELNPRKESLELRHSALLGKHLDATNSTSGISIYGVDSISHYEQALRQVRYRNWRPASLSE
RRFRLTCSELNGRYTSNEFNIEVSLLHQSAPVEHVNHMAANPQYMRPVHHPLMIHTFNSH
MSEAAPPAATVVIVVCIAALVVIVVIGVYRIHATHQEETRDDDDEAKEPEEDWDNSALSI
TVNPMENLKGLQALSKVVKEGRTEEEEEDEEQVGGMSSAESDYSDDETHPHTPTHTH
Download sequence
Identical sequences H2RKH6
ENSTRUP00000000639 ENSTRUP00000000639 31033.ENSTRUP00000000639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]