SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000000657 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000000657
Domain Number 1 Region: 2640-2895
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 8.63e-37
Family Hect, E3 ligase catalytic domain 0.0035
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000000657
Domain Number - Region: 982-1141
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00198
Family SPRY domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000000657
Sequence length 2898
Comment (Takifugu rubripes)
Sequence
NKIKELELLCSLKEVPLDFRDLENVVLSLREKFFQDVNTGHLRSGPSLAKTKALMKSLMN
RSELLLHVTIASQCRSLTNTPAGTPGPASKSVSDAKSVNPMVKQPVFLRSMSAPSDLEMI
ANQDVEFTHAPQRRRHHPSSHRSSSFTLLQSLAIEDSRDKPTYSVLLGQLFAFIGTTPDQ
AVSSSSFLSAAQTRWRRGSTRKQALVHMRELLTAAVRVGGVTHLVGPVTMVLQGGPRIEE
LTCGGMVEQVQDAFGETMTSVVSLCARYPIACANSIGLLCTIPYTRSEEQCLVRSGLVQL
LDSLCSLSGQRENSSSEKQTKKQKVATMAWAAFQVLANRCIEWEKVEGGSRDAVHSGLAR
QVSSLLTNHLARATECCGNQAAGNDALQDVLSLLNDLSRSHIGKAILSQPACVSKLLSLL
LDQRPSPKLVLIILQLCRAALPLMSVEDCGNVALPSWSYSINTLDTEQQDANDPASRIAA
LLLAKLADYVVPGCQTLLSPSSSEQDTSLSCATSKGALKPDDVGEEGEAVDGKLSIFIHK
REDQSSHEVLQPLLSSSEGRPFRLGTGANMEKVVKMDRDMTKSGSCEVITEEASAALRKA
NKWAQSGLIVSVGPPVEALAQEAAGGLTTGDKKKTAQTAVCRDRNAELARSDPIRPFISG
HVANSMAAEVIALLHSLLTAPESNTAQIWTSTAEKVLSRALMFIPQIGKYAESILENGSS
SGRKLAKLQTIGRQAVAALCALGGFKETIKIGSEVQVVGKGVLGSMGIVMSINEQEGIAT
VKFPSCEYRKSCKASDILTVPISRLSTPRSEALPLYKLSITEKVVQAVQSMLLPQEGSLS
IHTSLPATGDGSSPVMAAVRLLAEIRSRACLVMAQLLEDSSFCEEFIQQCPAAVEVLNLV
AQECSPGERLGIVEAQCERLRMLYRDCARPPPPPLQTDRCQPKEITWCPSRVFPPVRACM
FSSRLTSVTFLADPSAGGGLPRGTFIYATSPIPIQAPSFYWEIEIVSYGDSEEDSGPIVS
FGFATEAEKRDGAWTNPVGTCLFHNNGRAVHYNGSSLLQWKSVRLDVALLPGDVAGIGWE
RSECTPPPPGQAPKGRVYFTYGGQRLLPILEDVAGGMWPLVHIQKKNSKIRANFGGRPFA
YAEGQAHRNAADLCVDLAEEISANFEALPFAMASDSDNDAGASVTSDSGSHGPPCRIAAV
AVTQQQYNSDLSCHYKVELSYDNLVTTGPNPHPPSIADDESDDEDDDDVPREDHYALLVK
AWETKVFPTIRRRFRNEAERKSGLDQIKGALQLGMVDIARQTVEFLYEENGGIPRDLYLP
TIEDIKDEANKFTTDKVRKGLTVVIRCPESNNTNTTTGGTALPKFAIRGMLKTFGLHGVV
LDVDSVNELVQVETYLRSEGLLVRYWYPIEMLERPPAGSRRTAANGLVSLDSTNIQIHRE
LLRCESALARLYCRMALLNIFAPKNPHTFTRLFHIPAIRDITLEHLQLLSNQLLAPPLPD
GTISSSSILLGQSLLHNLQGQSCSPSELFYQGNAQPIQEWLTVAITRALHQGEESLLELT
KQVCCFLQNAPDQFTSEEFPVTESKVSMDVSFPGAAFVIVSCKESQLGCRKDSSLYKAPW
ARVMVYGLGHKVRRNGQLNLMEAVCYPLDASPTNTGLTPPPTTNQYPSVIIPTDKVHIKL
GVSPLPGAVLVLHSLPLEFPLAIAFAEQLLTWKLDESSERSEDEPDTVPPSVLLQVVELL
GGLLWTTDLAPSIKELIFHLLAELLRKIHHLEQQKCPSGLSSSIALLLNPCLAVLMALQT
EVRKLYDQETQGWTAGGAGAGGSSGGSVALALGAEQSRFSTYFHALMEVCLAVAEVTLPL
NVGPSPAGALSSTSAPTLSDSSSSSSSSPGQTPQSPSLLSKRKKVKMKRERAVAAVAAAV
SGKRGGGGAQVVSESDSALLNMAGGKPEDILWFHRCLTLLMILRHLANKDPQGLSVTCDA
VTDACQALVGATAHSRLLVLSGIPTHLEEAVVRNAIRRACNAHGGLFKDEIFIPVQEDDP
KKAKTGAGVCSTQDGKALPEAEPPFLNNEGPESPDSSSSATPALSVSSSASSFKHQRPAP
YVRQELLATTFNPDVALLGPCPQQDPQTVSSQESLDASLCSTGSLGSLGSLGEPLEGAET
PSVSDGGSMHTVTSLESTAAVSRPIKGYAVIEVRSRAKVEKIRASLFNSSDLIGLSSLDG
EDELMELSSEEILTASTVNQSLFDTQGSSALEDYFLDKSLRGDKIAPVVSDVLTDIFKSC
VHSEQMLSLTPAKPVKVSEIYLSKEQINAQTPGNLLHTFFTSVRPPKKVLEDQLTQILRK
YGAPKPNKNKYSKAGKEQHQGKVMSTKRPISKPPTKEKSVLNSVRTALSEKKAVLKSKSP
EKPRSDEKDLEKSPPKKAEVPEEKFLTLEGFHKFAVDRAKQDIRSVWRAILACGYDLHFD
RCTCIDTRHAQKACRKWSLEMDVALVQYINRLCRHLAITPARLHPHEVYLEPGDVADPRV
ACLLNEPVESLRLRFALLQSLNNTLENFFLPLVELRQTQTYRNSIAALLCEAKGFIFYDT
KVTVMNRVLNATVQRTADHAAPEITLDPLEIVGGEIRSSENSYFCQAARQLACVPSSQLC
VKLASGGDPTYAFNIRFTGEEVHGTSGSFRHFLWQVCKELQSSALSLLLPCPSAAANRNK
GKYILTPCPISYAEEQLLHFFGQLLGIGIRADVPLPLDLLGSFWKGLVGDPLDPEQDLQE
ADVLTYNYVKKFENVTDDAELEALCAEISSQHYSGESPDSPGRPCCTFTYITMTGEEVEL
CRGGRSLAVSWENKDVYARAVRSLRLRELQNPECMTAVRAGLSSIIPLQLLTMLTPLEME
LRTCGLPHINLEFLKVTT
Download sequence
Identical sequences H2RKJ4
ENSTRUP00000000657 31033.ENSTRUP00000000657 ENSTRUP00000000657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]