SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001167 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001167
Domain Number 1 Region: 494-719
Classification Level Classification E-value
Superfamily vWA-like 7.57e-62
Family Integrin A (or I) domain 0.0000984
Further Details:      
 
Domain Number 2 Region: 2-134
Classification Level Classification E-value
Superfamily vWA-like 3.86e-31
Family Integrin A (or I) domain 0.0014
Further Details:      
 
Domain Number 3 Region: 408-533
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000926
Family Growth factor receptor domain 0.0073
Further Details:      
 
Domain Number 4 Region: 728-769
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.00000000000105
Family Chicken cartilage matrix protein 0.0022
Further Details:      
 
Domain Number 5 Region: 286-330
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000914
Family EGF-type module 0.031
Further Details:      
 
Domain Number 6 Region: 166-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000519
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001167
Sequence length 770
Comment (Takifugu rubripes)
Sequence
QVRSEFSLKSHASLDSMVKAINQIIPLAQGTMTGLAIRYTMNVAFTAEEGDRSKVPNVAV
IVTDGRPQDRVAEVAAEARGKGIEIYAVGVARADMTSLRAMASPPFEDHVFLVESFDLIH
QFGLQFQDKLCVINLCLCVPVCPYPPVSPCVPVCPPVPPVSPCPPSVDLCSEGNHGCEQI
CSSSPGSFTCSCISGFQLNQDQKSCSTCFTAPSSTRLTLTSPCSSVPPAASQPNSEAPPQ
IQENIRFTCKANCHWLLLNANFRTQIKSRLMQEEQKCTCAPFCATCSLIDYCSFGNHSCD
HECVSVLSGYHCRCNHGYRLLNDGRTCQDVLTGASTEPVMFQLHTHTHTHTHTHTHTHTH
THRHILKGSNKTICVCVCVCVCACVCVCACVRLCVCVRACVCVFVCVAIDLCAEGKHDCQ
QICISSPGVFTCDCNEGYTLNEDEKTCTPVDLCAEGKHECEQLCLSAPGSFTCSCNPGFR
LNSDQQTCTNMDLCNSVGHGCEHQCVSTPGSYYCVCPEGRSLQEDGRSCGACRSANIDLV
LLIDGSKSVRPQNFELVKKFVNQVVDSLDVSPRGTRVGLVQYSSRVRTEFPLNMYHTADD
IKAAVMKVEYMEKGTMTGLALKHMLENSFSEAEGARPAKHNIPRIGLVFTDGRSQDDITE
YAKKAKEAGVTMYAVGVGKAVEDELREIASDPVEKHFYYTADFSAISTIAETLKLNVCPE
ESQGELEVKDPCACESLVEFQQATMSSLEQLTQKYAGMTSRLEQLENQLL
Download sequence
Identical sequences H2RM04
ENSTRUP00000001167 31033.ENSTRUP00000001167 ENSTRUP00000001167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]