SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001205 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001205
Domain Number 1 Region: 77-160
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.79e-21
Family Cold shock DNA-binding domain-like 0.0000206
Further Details:      
 
Domain Number 2 Region: 6-76
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 5.65e-18
Family ECR1 N-terminal domain-like 0.00041
Further Details:      
 
Domain Number 3 Region: 165-241
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 6.45e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001205
Sequence length 246
Comment (Takifugu rubripes)
Sequence
AAMISALKDKVGQILVPGDEFCCGAEDTISLTAHVQPEKVVCGPGLMRSADRLQVCKSGV
LRHKEPNMFWMDSQQKRYVPTKGDAVIGIVTSKSGDIFKVDVGGSEQASLSYLAFEGATK
RNRPNVQVGDLVFAHFIVANKDMEPELACIDGSGRANGMGIFGEGGLLFTVSLGLVRRLL
APHSEIRSDLQQLVPCELLVGINGRVWLKSSSTQRTLIIANLLQCCDTMTAPQRRQLFRR
VSQGPL
Download sequence
Identical sequences H2RM42
ENSTRUP00000001205 ENSTRUP00000001205 31033.ENSTRUP00000001205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]