SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000001262 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000001262
Domain Number 1 Region: 343-419
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000134
Further Details:      
 
Domain Number 2 Region: 114-196
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000409
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 3 Region: 38-112
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000644
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000001262
Sequence length 443
Comment (Takifugu rubripes)
Sequence
SKDQDKDNAFSNADANGKVGKRPAEDMDEEHAFKRSRNADEMVELRILLQSKNAGAVIGK
GGKNIKALRTDYNASVSVPDSSGPERILSVNASIDTIGKILLKIIPTLEEYQHYSGIDFD
SELRLLIHQSLAGGIIGVKGAKIKELRENTQTTIKLFQECCPHSTDRVVLVGGKPERVIE
CIKVILELVSETPIKGRTQPYDPNFYDETYDYGGFTMMFEDRGRRPVSGFPIRVRGGFDR
APPVRSSRPPPPSRRDYDDISPRRGPPPPLSRGGRGSSRARNLPLPPPPPPRGGSLCCSE
RRSRGDRYDSMVSAVGRLKPSEAPCPKNNNSSWERFQSGSRGSYSDIGGPVITTQVTIPK
DLAGSIIGKGGQRIKQIRHECGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNRHA
HQFTPLMSCSRQSNVRQYSGRFF
Download sequence
Identical sequences H2RM99
ENSTRUP00000001262 31033.ENSTRUP00000001262 ENSTRUP00000001262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]