SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000002475 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000002475
Domain Number 1 Region: 2954-3101
Classification Level Classification E-value
Superfamily CalX-like 1.06e-30
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 2 Region: 3927-4072
Classification Level Classification E-value
Superfamily CalX-like 3.92e-29
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 3 Region: 2232-2381
Classification Level Classification E-value
Superfamily CalX-like 1.44e-27
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 4 Region: 1721-1809,1837-1870
Classification Level Classification E-value
Superfamily CalX-like 6.15e-27
Family CalX-beta domain 0.00071
Further Details:      
 
Domain Number 5 Region: 4408-4553
Classification Level Classification E-value
Superfamily CalX-like 1.31e-26
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 6 Region: 2114-2243
Classification Level Classification E-value
Superfamily CalX-like 1.7e-25
Family CalX-beta domain 0.0019
Further Details:      
 
Domain Number 7 Region: 4268-4401
Classification Level Classification E-value
Superfamily CalX-like 2.49e-25
Family CalX-beta domain 0.00078
Further Details:      
 
Domain Number 8 Region: 789-928
Classification Level Classification E-value
Superfamily CalX-like 1.83e-23
Family CalX-beta domain 0.007
Further Details:      
 
Domain Number 9 Region: 2595-2711
Classification Level Classification E-value
Superfamily CalX-like 2.49e-23
Family CalX-beta domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1005-1132
Classification Level Classification E-value
Superfamily CalX-like 3.14e-23
Family CalX-beta domain 0.0013
Further Details:      
 
Domain Number 11 Region: 4053-4190
Classification Level Classification E-value
Superfamily CalX-like 7.46e-23
Family CalX-beta domain 0.005
Further Details:      
 
Domain Number 12 Region: 405-553
Classification Level Classification E-value
Superfamily CalX-like 5.23e-22
Family CalX-beta domain 0.0059
Further Details:      
 
Domain Number 13 Region: 1129-1282
Classification Level Classification E-value
Superfamily CalX-like 1.83e-21
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 14 Region: 152-286
Classification Level Classification E-value
Superfamily CalX-like 4.19e-21
Family CalX-beta domain 0.0018
Further Details:      
 
Domain Number 15 Region: 1303-1493
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.57e-21
Family Laminin G-like module 0.055
Further Details:      
 
Domain Number 16 Region: 3578-3666
Classification Level Classification E-value
Superfamily CalX-like 5.49e-21
Family CalX-beta domain 0.0026
Further Details:      
 
Domain Number 17 Region: 1870-2008
Classification Level Classification E-value
Superfamily CalX-like 2.75e-20
Family CalX-beta domain 0.0043
Further Details:      
 
Domain Number 18 Region: 4664-4806
Classification Level Classification E-value
Superfamily CalX-like 3.14e-20
Family CalX-beta domain 0.0046
Further Details:      
 
Domain Number 19 Region: 5007-5177
Classification Level Classification E-value
Superfamily CalX-like 1.83e-19
Family CalX-beta domain 0.00074
Further Details:      
 
Domain Number 20 Region: 3091-3201
Classification Level Classification E-value
Superfamily CalX-like 7.72e-19
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 21 Region: 3775-3911
Classification Level Classification E-value
Superfamily CalX-like 1.83e-18
Family CalX-beta domain 0.0022
Further Details:      
 
Domain Number 22 Region: 3670-3791
Classification Level Classification E-value
Superfamily CalX-like 2.62e-18
Family CalX-beta domain 0.0064
Further Details:      
 
Domain Number 23 Region: 1569-1699
Classification Level Classification E-value
Superfamily CalX-like 4.32e-18
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 24 Region: 34-155
Classification Level Classification E-value
Superfamily CalX-like 9.02e-18
Family CalX-beta domain 0.0021
Further Details:      
 
Domain Number 25 Region: 908-1005
Classification Level Classification E-value
Superfamily CalX-like 1.7e-17
Family CalX-beta domain 0.0039
Further Details:      
 
Domain Number 26 Region: 263-400
Classification Level Classification E-value
Superfamily CalX-like 2.49e-17
Family CalX-beta domain 0.0048
Further Details:      
 
Domain Number 27 Region: 1972-2089
Classification Level Classification E-value
Superfamily CalX-like 2.75e-17
Family CalX-beta domain 0.0016
Further Details:      
 
Domain Number 28 Region: 2699-2854
Classification Level Classification E-value
Superfamily CalX-like 5.75e-17
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 29 Region: 653-784
Classification Level Classification E-value
Superfamily CalX-like 9.55e-17
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 30 Region: 2818-2950
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000131
Family CalX-beta domain 0.0032
Further Details:      
 
Domain Number 31 Region: 4173-4278
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000222
Family CalX-beta domain 0.0052
Further Details:      
 
Domain Number 32 Region: 2345-2390,2492-2570
Classification Level Classification E-value
Superfamily CalX-like 0.00000000000000419
Family CalX-beta domain 0.0054
Further Details:      
 
Domain Number 33 Region: 5163-5293
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000719
Family CalX-beta domain 0.0068
Further Details:      
 
Domain Number 34 Region: 1500-1577
Classification Level Classification E-value
Superfamily CalX-like 0.000000000000785
Family CalX-beta domain 0.0075
Further Details:      
 
Domain Number 35 Region: 5286-5426
Classification Level Classification E-value
Superfamily CalX-like 0.000000000144
Family CalX-beta domain 0.008
Further Details:      
 
Domain Number 36 Region: 5417-5558
Classification Level Classification E-value
Superfamily CalX-like 0.00000000785
Family CalX-beta domain 0.0071
Further Details:      
 
Domain Number 37 Region: 4527-4652
Classification Level Classification E-value
Superfamily CalX-like 0.0000000183
Family CalX-beta domain 0.0085
Further Details:      
 
Domain Number 38 Region: 4766-4876
Classification Level Classification E-value
Superfamily CalX-like 0.00000209
Family CalX-beta domain 0.008
Further Details:      
 
Domain Number 39 Region: 3205-3268
Classification Level Classification E-value
Superfamily CalX-like 0.0000051
Family CalX-beta domain 0.0074
Further Details:      
 
Domain Number 40 Region: 518-647
Classification Level Classification E-value
Superfamily CalX-like 0.0000144
Family CalX-beta domain 0.016
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000002475
Domain Number - Region: 4915-4972
Classification Level Classification E-value
Superfamily CalX-like 0.00379
Family CalX-beta domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000002475
Sequence length 6223
Comment (Takifugu rubripes)
Sequence
YCCSSLAGMFPVLAGLILALCTSRTACETATLRFLGQTNFVVNESSTTVVRLVVERVGDP
VNVTALVLLEGVDTGDFEAINAAAFLLSSESRKTIFIAVKDDDLPEADETFTFNLTLQSS
SNGVRLGAPSKATITILSNDNAFGVIAFNSTEDVVVDELRGRNHVVPLTLIREKGTYGTV
TVNFQISEGPNPATDDLSPDRGKITFPVGRAVAQFTVLVRDDQIPEDDEVFAVRLTGVEG
GALLRADASSIQLRIRRNDSPLRFAQSAVAVPESAGVIALNVTRGRWTEDGPLVGSVDTE
VSVDYMVVSGEGLGSATPAVDFLNLQPVRTITFPPFVYTTNLLFKISDDEVPEIAESFHV
VLLEETVVGDAVLVPPNAVHVTIEPNDKPHGVLSIGSGAVIRPITINEDLTQSRRFEGIV
IVRNGGSYGSVSANWTISRNSSDPTPVSDDLTPAAGTVRFAAGQVTAVVPLNIVADVVPE
EAEAFILQLLPSSVTGNAEVDEPMEVTFYIQDSDDVYGLFRFDQEKEQSVQSQPEGRFLS
LHFLREGGALGEVSMALTALYIPAGPLDPARARDQVLNVSRNVDVVFAGERTLHVILPIR
NDAFLQNGAHFLIQLDSLDLVDIDVPIPSNSPRFGGPLNLTLTITPDIANGEIGFTSNTT
VVLYEPDDNSSSTVNLPLRRDGTDGQAEVFWSLQPLGANRADITDEDLQPVSGSVIFLSG
QSDASINFTVMADDIPEVNETLLLTLDRSNVKNQILKTGFTAREIVIVENDDPGGVFEFS
PSSRGPWLINEGEAVELHVVRAQGQLLKQLVRYAVIPSGHAEFYGATGILEFKPGEREVL
VALVARPDEVPELDETFSVVLSSHSTPASRLGDHREVNITIRKNDDPFGVIEFIQWGLVA
TIKESREDDMHSAVFPLVRKRGLFGEVTVSWVLEPSFSGDVSPSQGNITFKDGEYLKNLT
LFSVPDQIPEATENFTIAVVKATGGARLGNIRNADLQIIKNDDPIFFSEPVVVSLQEGAV
ANLSVVRTGRADSVATVMYHVEYGAASPGDFTLLSNETLLVFDVGEWVKNISVALEDDDI
PETDEPFYLLLSNASGDAVVYGAVKATVVIEANDDANGIFSLEPTEKAVEEGHTNHFNVL
RARGHFGDVTVFWQLFANDSASPLEKNEEFTSTSGSITFTTGEETKPIVLQAISDKLPEF
NEFFVLKLVNISGGYPGEGGQLAESFLNASVHIPFNDDPFGVFAIADSNLDQEVAEDVLS
EDDMADVTSFTILRQQGTFGDVRVAWEIVSGRFADGLPLMDDLLLLASFPDEVELRPHAR
RHHSATDTWFFSGLPGAYGTIASEDGPADVGNFTFSAWLVPTIDTGGFIVSKGAGNGSLY
YGVKIHTNDSHVTVMLHYTATGSKTQQVARADKLVENHSWIHVIISVDDGIIEFMLDGSP
VPGGLKSVKGEGIADGPAAVFIGSDPDGEQRYTGLLQDVRLYRTKLSRSQIHELHSQPPK
ADLRTISGYLRYLQDERQKSFVVEVRDDDVEEGEEIFYLQLVAVRGGARLPFPRPTATLR
VMKSDNANGLFGFTGSCIPDTADEGSTVSCVIERVRGSLDHVYVNYNVTQLDSSNSETPV
HQDFVNATGAVLFLPGQRSEVLNLLVLDDNLPELAESFQVTLVSAESGDGKPGSTPTSGA
SIDPNSSVTTVTVTASDHPYGIDHHTIGKPLTPGEGLISPALEPAQTTVNEEDGDIRLVV
ARAQGLLGRVLVGYRTTPFTASSPEDYEDSEGILDFLPGERLKFITVTVIDNPVPELDKI
FRVELYDTDGGVDHFLHSEGSGSGDNESDFLPPPYHHHASLGLASRITVTIAASDDAHGV
FQFGPESLSVAGTEPEDGHSSVVLQVERTFGDLSSVIVYWEADPRSERELLCWSGNITVG
VGQRSGNLTINVAQDEIPELDQSFAVSLVNVSHGRLGARTSATLTVLASDHPYGVFVFAN
ETRHVRLPEADATVSLTISRQRGLMGRVRVTYGTLREAQAEPYQTPGVGRATEGRDFVPL
LGSVVFLANQREANISLQVLDDEDPERDESVFVELISVELLAGEQERLISTSPSLGTKTE
AVAQVILEASDDAFGVLQLSASAVSVAEDYVGPIINVTRVGGIFADVSVKFRAVPLTARV
SEDYSVASTDVVLLEGESSKSVPIYVINDVVPELEETLLIELINQTTGGALLGEVTRAVI
TILPSDDPFGAFVFQAVPFTIEEPKSDSTEVSLPIVRNAGAIGTVVVQWRATVHGELAVE
DIQPTSGEVSFAPGETMKVLRVAILADDVPEITEVIKVQLTGASNGGNLGADTSIHIIVP
ANDNPHGTVYFQQPVYRVQEPLEGVYSANITVTRGGGHFGRLEILYSTAELDIVGLAQSG
GQNLLMYFDLPKAGIPSAALLRTANITGHSDALTACAAACLRERACQAFSLESGATSPSC
TWVTLEVVQLELRSDVLTYAKNSSAAAVLFSAQAAAGSDYTPVAAQAAFVEDGSGLANLT
VPILTDKFPEMDESFAIQILRVSLLNLSVAERNVPTIGQPDKALVTIGMNGDAFGVFLIY
SLSPSATEDGLYLEVLEEPSVVVPLVIERRGGDLGRVTVEWRFVGGEATPDTDFTGTGGT
LVFDGELKKTVEIVISDDTEPEDNESLMIGLVNTEGGSRILPSSDTVTIVIQANDNVAGR
VGFHPASRSVVAREGETLSLLVLRTAPGLGNVTVDWTLEGPFVPRTFSKSSGTLFFTKGQ
LNDTIHLQLLDDATPEDKDEYKVSLSDIKTFGVASSGHATLDPQHRQAVLTVDTSDEPYG
LLSIAPSSLMVTTEERHQTINIYVNREFGASGAVNISYEVTAGALRDLSPIEGALADPGL
DFVSGTGSVILQDGQTSVAIPVTIMEDEIPELQEFFLVNVTSAVLITTFATVPQLDTQGL
VAEVSIAANDGIRGVIEWTNTMFEVNETMGTLTIVAYRNKGTYGNVSVFFYAQNLEAQQG
LDYNTSETMLLFVHGERHKYVDVQIIDDAIPEGAERFQLILSKPSSGLELGTNTTATVNI
LASDDGHGVISFNSSQHFLLKEPTSLSSLSESVATLYVVRNPEDGTFGTVTAQFTITDTS
GNLADADLRPAQGFVVLEDGVRLEMVEIWAVLDGEPEGNETFTVMLSNPTGGARLGEQLQ
TYVTVLENLAPAGLFRITPSINRSDTEVRADEGGRTVFLTVSRSHGLGSAVSVEWETQSG
TAVASEGHFLAMGVYQSFVDSPTSAWCALPHQHSFLAMRLDKRAVVGSSHTLATLYRWQG
AFVAVESIRIQEPGSCVGFALNGSTYVGVTHPGPPSAPAANLSIYKLHKDLNVTLVQTLG
IESLDVKHLIIGDQQYLIASSQVRPNSMLQIFVWTRGSFSLLQTLDVQGDILSVAPVTGD
VVPHLLVCVDGQNVSCVLLRWTNRRFQTPQPLKLNGRVLQAEVSFLWLCVIMAVAAGLPS
SCEVLQWSAQQTLPQRRQSIPHPGLSSVHPFTAPSGTTYLMLAGLNGSSLYSWRPDTELF
AVILRAPAARSFLSLPVSSLNTTKMLLASTGDDGASVYQLSAVSNQSDFIPSSGELHFAP
GDRELEIAVNIIDDDVPEEQEYFHVALKHPKGGAEIGFGGQMTIVVPANDDAHGVIGFAE
NFLSMEVEELEQNNQISLSVERKRGTFGRLTVHWAADGSLTDIYPTSGVVTFSEGQHSAI
ISLSVIADGVPELRESVTVTLMDVTTVGLQDLRQAAVIDKQRAQAQLTILPNGSPFGVIG
WHLDSQFMLTKEPEKTPFNITLSIVREQGSSGQVKVHYQTKVALYLPPSNQATAGLDFTP
RDDAVILTDGATVALVTLTILPDDVPELAESFLVNISGVELIQGSEVAGQPSVKRPGMEV
AEVTISENDDPRGILQFNVSDGFGGTVTAYEIPSPDNILYLPVARLAGALGRLVVYWKAE
ALTADFKDFSPTSGNISFQDGQREAMIAVTILDDESAEREETFRVELLRVIGGARLGGMT
SVTISIPSNDSPLGRFGFQGLEFQVSEPEREDDPAAQVTLTVVRSEGGEGAVTLLWQLEE
QAVDDLSPLNGTLVFTEAQTLETFTIQALPDSALEGEERFNVRLLPAETDAVIDPLNAMA
TITIRADRAALGIIGVAEASRNILIGEPRGDYDGSAVVHLVRGPGVFGEVQVFWNITPAV
FSEFETFSGTVTMRDRQSEATITLKARDDDLPEERREYLLTLTSATPGLDISHISKHAKI
TMAASDNPFGVFSFAQQEIRLREEEGMVNVTVDRSSGSLRSVWVTYQTLGHTAASGEDFT
PASGRLRFTEGQTSEQVTLHIRDDSLPEGPEVFFFNITEVELVNVSDVDYTITETGLQRD
QPPTIGDLFSLAVVILTNDNAEGILEFRQDFVDITVGEDAGIVTLPVVRRAGSLGVVSAQ
VISKGLSATSGLDFSLENVSVVFANGQNISQINVTIIDDFDSEYAEVFEVWLAGTTGGAV
LGSQHVARITIAKSDSPGGVVRFLNESLITVTNPNSTLKLRLVLERAGGGVGNATVAWII
RGPNSREALPASNTDIREPVNGSFFFSDGEEGPRSIELRVLPHGEVEVEETFVLELSVLS
GEVDVDPQAGSVTLKIEKFGDPNGVVQFSESALREQVFNESRDDEGPFNISLPVIRREGV
MGDITVHWQIESDSDITGDFLTVSGSVRILQDQREAEIVLRLMPDSVPELEELYIVLLTG
VEGGARLAQDPAFITTHIRVPANDEPHGVFSLSPHQQPFVVLGSGSEVSRALSMNVTRLA
GLFGNASVGYQIRGAVEEVRDMEEILGEQAEGRIFFRENCSVATVTVPISNQVFLSVGEI
FTIRLADVRLLGPLMGSAPRLLEASVMTAAVPEEAANSEVGFEFLALRVSSVELGTCEAK
VTRAGVFGDVGVQWSAGHPSGEASPGISPSSGSLFMAHGERSKVISLTAAADLSGLASYA
IHLTGATSHTSPAKLRSGFTLAVVEPLGIYQFAPASRHLVIAEEIQTITLYVQRLYGSHG
NRTQLSYSTTAGSATAGEDFVAVADGRLVFDSPRQTNASFRLSVLDDALSEADEDFHVHL
TDVQAAAPDATWADASPRLHPRHSVATVTILASDVTGGVLSIGPGLVRTPEDGVDDTQRE
RRIVLKVRRSDSVAGGVRVRVRAYGGACSPSPAGSAAPLPFAVESTEALAKEEEDFRLET
RVASFQAGQSETEVILVILDDPEPEGQEVFFVYLSEPEGGAQITDSPNQGFGAFSKITIL
GSDFHNGIIGFSLGSLTGPVLDEDSENRTVLLYLQRQENRAFEDVQVFWRVTFSDKMLSL
TNNGVDLSGELVRTSGIALCRRGDIICTLTVEIQDDEEPEDQAWFLVEIYRVGAGAAINQ
TTRFANVTMAQSDDPRGVVYFSVGHRLPVATPTTTKLTLQVHRRASAASAGSVQYRTLEL
PRDEVLGPAIIHAAKSGVDFPRQEGWLTFEVGQRNTSLDIGLLRHLASSLATPKRFQVEL
FNATGGAKVHPKFGMANVTLVSNAASQAVWALLEQLHQPLGPDVLNQVLRRLIDEAAAPL
SHEQMAAVLEALEKVITEAERAPLQESSRNLTYDLLCTLASPSRTDTRGVSHLAEVAERF
AFSLLTDSQCEIHTHRRGAVLETCPHMTISAFQWYPTQINGYKFRGRNADFFQLPDTLLA
VPAGLTAECSNLSRIQLTEFKTEHWFLTNDTTKALNGKVFSASFQQRGSQPLKDGNEVVY
RIHTPVHVTPGQSRCLLWNQTAASWSSDGQYCRVVKDSVNYVECACSHLSVYAASAEFAT
LASYNEAFYASGIICISGFALAVLSHALCSRVPMFAAKLLTHMMLSCLGTQMCFLVSAFR
GPLFSEDSCAALALFSHYFHLSQFFWMLIQAVNFWQVLVMNDEHTERRYLLYFLLGWGLP
ALVIIVQVVVLLGGYGWSIHSVYGLVRGDVLLEFQNKYIFILEWKPSICLILIHPVIQRR
SVLFCTSFSGCFSCVTNGRTNSSEVPLVLYLFLLISLVWLWAGLHMGYKQLWMLILYVIF
NCLLGIYVFAVYFIMHNQLCWPTKASYTVEMSGHDGPDSSYQGGGPTSAGGDINKSTQNL
ISAMEELSADWERASLQPTSQPSGVFKSSPVVGTYTTEGFINSNLVSTEEESQEFDDLIF
ALKTGTGLNLSDNESIHGSHDEGSVTNSQIVELRRIPIADTHL
Download sequence
Identical sequences H2RQR0
ENSTRUP00000002475 ENSTRUP00000002475 31033.ENSTRUP00000002475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]