SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000002790 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000002790
Domain Number 1 Region: 317-522
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.74e-26
Family Laminin G-like module 0.013
Further Details:      
 
Domain Number 2 Region: 540-742
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.97e-26
Family Laminin G-like module 0.016
Further Details:      
 
Domain Number 3 Region: 763-972
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.95e-19
Family Laminin G-like module 0.0083
Further Details:      
 
Domain Number 4 Region: 35-77
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000525
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 5 Region: 1172-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000025
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 6 Region: 152-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000084
Family EGF-type module 0.0044
Further Details:      
 
Domain Number 7 Region: 73-115
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000142
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 8 Region: 1-42
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000616
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1003-1040
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000679
Family EGF-type module 0.0077
Further Details:      
 
Domain Number 10 Region: 1077-1117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000159
Family EGF-type module 0.018
Further Details:      
 
Domain Number 11 Region: 111-149
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000103
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 12 Region: 1141-1176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000379
Family EGF-type module 0.01
Further Details:      
 
Domain Number 13 Region: 228-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000612
Family Growth factor receptor domain 0.0093
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000002790
Domain Number - Region: 742-787
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000218
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1040-1080
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000248
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 189-209
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0648
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000002790
Sequence length 1282
Comment (Takifugu rubripes)
Sequence
CSPNPCQNKAICRPRGGGYSCFCVPGFQGGRCQIDVNECASQPCRNGATCEDRVGTFSCL
CSPGFTGATCEIQIDECQSQPCLNGARCHDYTDGFACICPSGFQGHKCEFNTDECQEQPC
KNGAPCVDGVNGYSCDCSHTAFTGTHCETPRPPCHSGPCLNSATCQDHQGNYTCVCWPGF
EGRHCEIDINECGSSPCMHGGRCVERSWQTLYGTEPLLPQRYDRQRAAGYICSCPPGTTG
SLCQEVINLCDPDPCQNGGRCEGHVGGYTCHCLKHSGHGVLYGGQNCDERLVGCDGHACQ
NQGSCIPSLLDGSHGYTCSCSPGYTGLLCATPTTFSFERRGYLLLRSPLAGARPHYNITL
SFRSVLPRAMLFRRNSRGSLLSLELDEGRLRLTLRRNASAGAEADGLSQVLELPHNVTDG
DWHSVETVLRNRVLSLKLLDDSVSCARQPCHKAIPVQSAPVSLASPPHNTFIGGVLQPRV
GPSEEDPVPSFIGCMRDVFVDRQLVVPEEWPKNSAVNVSSGCNHRDRCLDVPCKNGGQCV
NLWQSYRCRCPRPYEGQDCEEEHVTARFGDGDSHSYAVFTVSRDMGRDFAVSLFLRTRRL
DGFVLALDNGSSRYLHMWLEDGRVAVQLGSLEILKSKSPINDGGVHFVSLEIEASRMMLR
VAAQKQGEVEVGTVGVEAGHSVYVGGLTGSRMTSVFGGYLKGCVQDLRVNDRRLQFFRLH
ASVNSFPLKLMENVTAGCSGDDGCRRKPCLYGGTCFSAWDDFTCACPPKTAGRRCEEVRW
CELSPCPADSECRVLNQGYECYSNATFLNDSTVLTYRGNGQISRNLTSLSLNLRTRKRNV
AVLHAESGSAFITLSVQDGFLFLELQSTAEEGRDEAGAVSTISLSSRSGVSDGEWHSVQL
FMATPWAPTSRWTLVLDEKIEEASVSRTKGGNLDFLREEVDIFLGGLAPDAGWSLSGCLS
TVELGGIALPYLGPSEVNLTRSQEEQFVQTSPRPPLLGCSGAPVCDSNPCLNGAECQDLF
NAFDCSCVDGWSGRRCDFFTDTCASGPCVHGNCSVRGLTYECACDFGFAGVDCNEKVDVC
ETHRCANGGTCLHGPDRYACLCPENFTGPLCNERIEEIPWYIVLRKVRPKLPVSVCGDET
RNYTCFNGGNCTDRELSCDCPPGFTGHRCEQELDECKSNPCQNGGYCHNLINKFVCVCDM
SYAGDVCQTDLTSEGLTSDLLLSVSLVSVLLLVALVLTSVGLAAALGRRATHGTYSPSRQ
EKEGSRVEMWSITQTPPRERLI
Download sequence
Identical sequences H2RRM4
ENSTRUP00000002790 31033.ENSTRUP00000002790 ENSTRUP00000002790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]