SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000002841 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000002841
Domain Number 1 Region: 34-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.12e-34
Family Pentraxin (pentaxin) 0.0000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000002841
Sequence length 233
Comment (Takifugu rubripes)
Sequence
KRRFNRIWKETSKNNILNCLFLLPLVSLLLLLDLSGKLLIFPRESNIDHVKLKTSKTVLN
SVTTCFRFMTDMSKSYSILSVATAAHTNAFVLYKTDEENVFRVHVLDGGADFRSVPIAPN
TWHSMCTTWDSATGLAQLWLNGNSTIKRYVKNGPITGALSIVLGQDQDTYGGGFDAKQSL
VAMLSDFHMWDYVLPAAEIRLNMDGPCFTPGNVFDWRNIQHELAGKVILAKAS
Download sequence
Identical sequences H2RRS5
ENSTRUP00000002841 ENSTRUP00000002841 31033.ENSTRUP00000002841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]