SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000004113 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000004113
Domain Number 1 Region: 3579-3744
Classification Level Classification E-value
Superfamily Fibronectin type III 1.28e-35
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 2 Region: 3928-4129
Classification Level Classification E-value
Superfamily Fibronectin type III 5.21e-33
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 3 Region: 4334-4511
Classification Level Classification E-value
Superfamily Fibronectin type III 8.83e-33
Family Fibronectin type III 0.002
Further Details:      
 
Domain Number 4 Region: 4143-4330
Classification Level Classification E-value
Superfamily Fibronectin type III 3.41e-32
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 5 Region: 4516-4699
Classification Level Classification E-value
Superfamily Fibronectin type III 1.48e-31
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 6 Region: 1543-1708
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.24e-31
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 4719-4896
Classification Level Classification E-value
Superfamily Fibronectin type III 1.41e-30
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 8 Region: 2381-2577
Classification Level Classification E-value
Superfamily Fibronectin type III 2.34e-30
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 9 Region: 2189-2372
Classification Level Classification E-value
Superfamily Fibronectin type III 2.45e-30
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 10 Region: 1180-1301,1332-1386
Classification Level Classification E-value
Superfamily Fibronectin type III 7.1e-30
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 11 Region: 3750-3930
Classification Level Classification E-value
Superfamily Fibronectin type III 2.38e-28
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 12 Region: 2575-2715
Classification Level Classification E-value
Superfamily Fibronectin type III 3.67e-26
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 13 Region: 3080-3209
Classification Level Classification E-value
Superfamily Fibronectin type III 3.42e-23
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 14 Region: 2871-2911,2938-3063
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-22
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 15 Region: 2734-2861
Classification Level Classification E-value
Superfamily Fibronectin type III 3.04e-21
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 16 Region: 1385-1543
Classification Level Classification E-value
Superfamily Fibronectin type III 1.47e-19
Family Fibronectin type III 0.006
Further Details:      
 
Domain Number 17 Region: 123-292
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.31e-18
Family Laminin G-like module 0.091
Further Details:      
 
Domain Number 18 Region: 4896-5040
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000119
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 19 Region: 1735-1880
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000134
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 20 Region: 1942-2078
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000218
Family Fibronectin type III 0.0025
Further Details:      
 
Domain Number 21 Region: 2094-2184
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000257
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 22 Region: 1070-1167
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000365
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 23 Region: 3182-3209,3510-3569
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000212
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 24 Region: 655-705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000145
Family Laminin-type module 0.0074
Further Details:      
 
Domain Number 25 Region: 708-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family Laminin-type module 0.0044
Further Details:      
 
Domain Number 26 Region: 762-806
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.007
Further Details:      
 
Domain Number 27 Region: 589-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000614
Family Laminin-type module 0.023
Further Details:      
 
Domain Number 28 Region: 811-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000781
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 29 Region: 863-906
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000865
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 30 Region: 919-965
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000151
Family Laminin-type module 0.0064
Further Details:      
 
Weak hits

Sequence:  31033.ENSTRUP00000004113
Domain Number - Region: 969-1012
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00017
Family Laminin-type module 0.01
Further Details:      
 
Domain Number - Region: 1020-1068
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000179
Family Laminin-type module 0.017
Further Details:      
 
Domain Number - Region: 532-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00213
Family Laminin-type module 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000004113
Sequence length 5265
Comment (Takifugu rubripes)
Sequence
VSSQVGNAHCGLATVCRVYIIFNLFIYLLLTESSGNFPQMENIAAYKPISTFPSRSTCGL
PERSSYCQSASSHNDLVTCYQAFCVQDCPYRSSTPPFAPLLLRSHRSNCVTEDVNDTRPG
KRISGGSSSVLFQPSRSGCVLSPPSQKLGVLGSLTLAVWIKPRSSEEMMLLEKSSAEGLL
FSVTLSDQALTLRHGQTPLAISFRTKGRIPLKSWTHLVLQVHDRHVSLFLDGLEEDGTPF
DTQILSTRLSDSSEDGAAMWVGLSSNGSNQFIGWMQDFRFYPATLANREIMEVYSGVLPK
IHAQPECRCPQTHPRVHPLVERYCIPSGVEDTTNDRVLRLNLNAHPLSYMNDQDMGTSWI
SKIMSTQELDEGVTITVDLANGQYQVFYVIVQFGGLLPETVLIQRRKVDPTDLDGDHRME
QPWLDWQYMARNCSVFQMQNNGPLLKSDSVNCMQLPKDVPFSGGNITFSLLTPEPNLRPG
YNDFYNNPALQKMVHASQVRIHVSGQYYTRESTVNQRHRYYAIKEITISGRCECHGHANH
CDTSLTPYRCLCTPESHTEGYNCHRCAALYNDKPFRSGDQLQPMSCRPCQCHGHALSCHY
DVTADDQPDEHYRGGGGICDNCIHNTTGRNCELCISGFFRLEGFDPTSPNVCQPCDCNIA
GTVNSSLICAQVGGQCQCKVAVTGRQCESCLPGWSGLKASNPNGCIRCNCSEVGTINTSA
GAPSCDQKTGQCQCKANVTGLSCDRCEFGYWNLSHPDGCIPCDCDPLGSLSQFCEPRGGQ
CDCKPGVRGRRCDSCGRGSYGLKLEGSCSSCNCSTEGALPGTICHPHTGQCVCKEHVEGR
FCDTCRHGYHTLERRNSLGCLPCTCDIYGTVPGKVCDEWTGHCPCQEGVEGSQCTNCAPN
YYNRSENFQKEGFWGCVPCICDPRGTVPGSVCDTTTGQCVCIPTHYGQDCSVCRPGFYLS
PDQNVCVECDCHPMGASQRGCDSQTGQCLCVHPSVGGRRCDQCRDMFYGFNPGLGRCQSC
ACDLMGSVNGSCHPDSGVCSCKLLVAGDKCDGCQAGATHFDPKNHFGCSKAPSQQPAPVG
FAVNYSSIKLSWHPPDSPNSNRLSYTLIRDAHTVHNIQRSYPFSPESFEDGGLFPYTNYS
YWLITANVAGVTTSTSASFQTLAAPPDKEQLHLTLVGQPRPTSASFNWSSPPNDTGPVER
FILSTTESAHGSQPVLHFSGLSTQAVVTGLQPFTQYTVVLEACSSGGCTSTPPLSFLTAD
APPQNQPPPTISALGPHSLQAYWEPPSQPNGVITRYEVFLRGPIKLQNPSTLNNERRVFV
SSDWVDSFGSLEAPPTNQSTFLPPHNSTTVTGLQAFSTYQMRVASTNLAGSATSTWTTAR
TMEGVPEWIAPPVVSALSSTSLRVEWNSSEGHGVIARGQVIEYQVSLLTEQTNNPHAPPL
ISHVMHRMRPSEQSVYVVEGLKPFQVYNFTVTVCTKTGCITSLPGAGQTLPAAPTGLSPP
RLYPVNGTSILIDWDHPAQFNGPQPLYQVERTDVSLSEPQDPVIRGTRFPGNSYHQFPSH
TLPVNRDFTGIELSFKTHSADGLLLAAFSPGNQEEFVAIQIKDGRPYFLFDPQGSAVVVT
VQGDGGRRYNDGRWHSITATRRGAVGTIIVNNQYRGSKSASSGSIIIGENTGVFIGGLPE
NFTLLREDPGDARLVPRGFSGCLRDMRFLTDSHSDEWEDLDWTAATRNAASYASWEGCPL
QSVDGAHFLGHSVAGYLEIDGDVFRGGQDFEISMEFRTDQLNSLLIFAYNKYTEDFMLVE
IEAGLLSVILAADGHMTELNMWVGLSYCGGDWKKLSLAKRGLLIFAAVDDWAEEVRGEAA
RLSVDSALYLGGVPMELHHPALHSHRHEVCRRLWLGGLHKGPDHTQCQTIDLNLASRRSL
RVYLDGCPTSESRYNCRGNDSVLVYSGRTPSATDSTLQPFSAQEYLYRFVAMATGGWAAG
PWQRSRSRGKAPRSVPSPTVVQILDGFSATVSWSPPSGDIRGLIDRYELKAYSRDQPEVP
PVKVTYSHGEFTGVLSGLTPSTKYLVTVSACGPPGCTESPRDNRAQESDLRSHFTTPEEV
PDAVSSPVTVTYPSALYLTWDPPASNRPNGRITEYLLYHNNQIVYRGQDRQHNITGLGVY
STHVLALSACTSMGCSNSSQVTVLTSQLPPGPLQAPTLTLLDSRTILVEWSRPTQANGVL
EFYSIFLSRDGSKPVLIYNSSELFEDHTLRSLSPGTAYTITVAACTGGGCTLSPPSQAHT
EESSPENVPAPLATPLSPHAFNVSWTLPHTPNGIITSFGLWLDGVQILNSSSTQRFFVVD
GLEPWSRHILRLQACTARGCGKGPMVEARTLEMAPEGAVLLELNHVSSRSLRARWTAPSR
PNGNLIYTLHYKRIYWIGCVVLCALIDGDGVLDRSTAAGSWLTVTDLQPYTNYSFWIRGC
NTQGCVDSLRVNVTTPPAAPDGLSPPRLVHATSRSLTVSWAAPAHSNAPGPLLYSLQMRA
TQQRPVIRLLENVTDTFSYHVADLSPHTQYWFRVVVVHTHGQTLSPWASLLTAEDVPGTM
DPPIVSELHPNSATITWTPPSPPNGIITNYSLCVCPSSVCSRIPGNITTSSLMDLLPFQT
YTLQMEACTRVGCSVSGMSESFRTLPAAPEGVPAPHLYSETPTSVLLSWGAPEWSNAPLE
RWVIERKVAGSKQVSTVGSLPADSPPLSFLDVSSALSPWTNYQYRLLLHNQAGNTTGPWV
NITTRPSRPAGLSPPKVNVLGPESLQVTWSPPLNPNGEIHGYEIRLPEPHISHNSGNTSD
LNVTVTDLIPCTNYSITVLACSTGGGHIGGCTESLPTSATTLPTIPEGLQPLSVVAISES
FLAVSWQPPRRPNGPNIRYKLLRRKTQQPLATASVPTETAPSPPPPEDLHRWLHVYSGTK
LFYQDKGLSRFTHYQYQLEVHNDVGFSTGEMVYAVTMAGIPHHRPSVSAYAINHTAVQVN
WTQPTLQDLQGEVESYFLSIEAAMFIQNLILPPSTVSTIIRDLWPSTTYLVSLQVSNGAH
NTTKASVNVTTEDGEPEGMMAPEVIPVNSSVARVLWLPPQQPNGAVTGYHVYVNDRLHGS
VDNSSGSYLLGDLLPFTVYNIQVKVCTVYACVWSDVTQTTTVEDLPADLVTPHAQVITPR
VVRLDWSHPSRPNGIMLGYEILRRTLRSCAPGSAVITSSLGEGCSYLECPATHGVCGMSC
FHTDTQVCCDGRIYTKRPGHHCCQSSYLSWSNSSNPVCCSGKLLQLLPNHQCCGEYYVPV
KSNEYCCPDHSWGRVSVGLGDSCCGGVPYSLRGGQLCCSGTLHDGFGVHCCGGRLVEDTL
VCCSDADGGEVHTYVPGFICCGQDYINSSTSLCCVSHDGKPTTHPAGNATVTLKCCGSKV
IHQEEECCNGIGFNPERHVCADRPTPGLPTQHQCLQGALCPIAAAQTAYCGTCDLNPSLT
TCTWVMSPHTLNVSSATDSPSINTMLCLSHEEVLYSGDANTHTFTDSDLEPFTVYQYRVR
GWNSFGRGSSPVTTVTTLEDKPWGVAPPHWRRLGERDDIIRLQWQAPARPNGEITHYVIL
RDGQERYRGDEHSFTDVGGIRPFQEYRYQLRACNRAGCADSMQVVAVTVQGVPEGVQPPA
VTALSSSSLQLTWSEPTHPNGIVQQYHLNQTGGGTIFTHNGGPKAYTVTGLQPFSEYSFV
LLACTAAGCGASSPSTGRTLQASPAGVWSKPRHLIVTTAVVELYWDPPQQPHGHISQYKL
KRDGQTVFTGDHDDQNYTDTGLRPHRRYVYELEASTEGGTAVSEKYSIQTPSSCPTGIQP
PHSVTVLGPRSVSLAWTPPAQLDDSQPVNYRVLLNPGSDMSEIHHAGLDLQLTVRALQPF
SNYLIRVQACQTEGCGVGKGVYVQTLEDVPEGLLPPRITAAGASVLEVYWSPPSKPNGLI
TSYHIYRRPMETEEELLVFIWSSGPLEFFDASPVLQPFSYFQYRVRAQNSKGSVLSQWAS
ARTLQAKPKNMPAPTGTPTGAYSAHLKWSPPQQPNGVISRHRLVYRKHQQDPTLNSTAVA
ALTVEGSIFEATIYGLEPYSQYSLQVEALNSAGSVSSPWVDIRTLEASPAHLTNFTVEQR
EQGRALLLSWEQPRTPNGIITMYHLYNEGNLEFSGLSRNFLFRRLEPWTMYSLTLEACTS
AGCTRTSPQDITTAAAPPASQHPPKPLFIGPDSVSLSWCPPTQPNGPIGEYFLLGRTLSE
DIGRGRSNEEDVEDGKVLFRESSPAHSESFSYTVTGLRPWTRYEFSIRAHNPAGHISSPW
VTVTTKQAPPLGLAPPTVRHLKDQPSKVWVSWTPPVEPNGVLQSYRIQRNNVSFSFSFDP
TVLNYTDEELLPFSKYSFAIIACTSEGCITSGHTNITTLEAPPASVEPPRVNSFTSTSID
ISWNKPLTQNGEVTEYLLKLNNQESYRGTDQNTVLSGLRPHTAYQLILLACTSGGCTTST
PISTVTDEAPPTDLPAPNLKVTGPESLEISWAPPEHPNGAITGYELRRDGEVIYVGTETR
YHDFSLSPNVRYSYTLRANNSKGAASSVAATAKTHPSAPSGVGLPTLTPLGPNEVKVWWN
SPARPNGDIVSYAVYQKDPVQLSITSTVITPDQSGFSDRHITLHGLTAYHRYEVRVEACT
VLGCSSSDWSSVLTLEAPPAGQSAPLLDLQPDTLTGLQTTFLVTWSPPTQPNGKVLHYEL
LRRHTSDNNTGDTTVLVYRNISSTYKDEALQPYSLYQYQVWAANSVGRSPSPWASGRTGP
APPEGLGPPVFLRVSATTAVLDIHPPPRPNGIISLYRVFSLHRNNRTLLSEGTSPQLTLH
DLQPYTRYRVAAEACTCYQCCSQGPMAELRTLAAAPALQPPPRPVSLTSRSVQMEWDEPL
APNGVIESCELHLRSSCPQPLQPVPIPCVEGPGEICFFGKRQHYNVTGLRPYSTYQLRAA
CFNNMGSAASNWTTVTTLSEAPQYMSPFLVDSNLTVIWLDWTGSFAINGYLREFSVTESQ
LRVYTGFYSQLQIPRTSQKTLSFQVTCTTNSGSVSTPTVRYSPALGIAPPEADDTDKQDI
SGSWTPVYSELWFILLLTLLGLFLLAVLLGLLLQRALRKNPSARECPPLVMLQRTNIKVQ
IYVVKESFLGLTDTKIVSSSSRFNPMSVLRVPHQAELTPTYSQHSLHRSISRLIDGKSLM
MEEGNWDNPPGHDSGLYVEEDELVDTLKALSTGTKEHTMFTDTHL
Download sequence
Identical sequences H2RVE5
ENSTRUP00000004113 ENSTRUP00000004113 31033.ENSTRUP00000004113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]