SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000004284 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  31033.ENSTRUP00000004284
Domain Number - Region: 154-207
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00095
Family SPRY domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000004284
Sequence length 221
Comment (Takifugu rubripes)
Sequence
MSSTGGGPSLTQRNYRLASNTDKPRTTGVVNDRLLSDYLHHVFPSCKPGLAPPSLRKPLG
FQDLGAHLETLLCEGEPAEDSRDQPVDGRLGPQPVVLDHTSGFEGLLFVDDDLLGVISVC
VCVCVRVSVRVCVCVRVRVRVRVLTTVTDRASLRNGQSLGTAFTNIKRGPGVAYFPAISL
SFKESGAFNFGRRPLRYPVEGYLPLQDPPTADLLKAHSLLG
Download sequence
Identical sequences H2RVW5
ENSTRUP00000004284 31033.ENSTRUP00000004284 ENSTRUP00000004284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]