SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 31033.ENSTRUP00000004379 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  31033.ENSTRUP00000004379
Domain Number 1 Region: 473-639
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-50
Family SPRY domain 0.00025
Further Details:      
 
Domain Number 2 Region: 149-210
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000168
Family B-box zinc-binding domain 0.00073
Further Details:      
 
Domain Number 3 Region: 21-80
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000139
Family RING finger domain, C3HC4 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 31033.ENSTRUP00000004379
Sequence length 644
Comment (Takifugu rubripes)
Sequence
TNIDRSFPPKGNMAESSFPSPPELYCPLCADALRDPVTIPCGDTYCLECIKIYWDQFDHM
GVYSCPQCRATFTPRPVLRRNLPDVNHEPRRQLPELMPFPYMHRESYCDFCVGRRNKAVK
SCLMCLAYYCETHVKPHYESSTFKRHKLVDETGHLDRKICPQHEKGLELFCRSDQMCICV
LCTVREHRGHNIASAEEERIEKQVSLKKILVVTQSEVQYIIQERMKELQELKHNVDVLKN
GAQRAQAESDKTFHEMLQAVERWKAEINQMIMANMQAAMGQADGYVERLEQEIMELQRRD
AELRQILETEDNIHFLQVPAGEAKCLCVPPEAMVPKVLINPQFSFAEMSKTAIDMKEHLD
DICKKELSKISKTGLCHADETQYIWYSTCFAHICNFIVHTVNETPVYILLPRNGDKRLKV
PSRADLQEPKTRADFLRCEYKRRKEKRIQECCMDTLNIGHKKPAYLALYSDSCKMTFDPN
TAYKELVMSDGNQKVMRKKTVHFYPDHPERFDGFSQVLCKEPLSGFRFYWEAEWTGEFSI
GVAYRSISRKGKNSHSLLGYNDKSWSLLCSDSGYSAWHSKVDRDLPDAPRATRIGVYLDY
AGNTVAFYTVKENMELIHKFKAQFSEPLYAGFGVGSSVTLCQLR
Download sequence
Identical sequences H2RW59
31033.ENSTRUP00000004379 ENSTRUP00000004379 ENSTRUP00000004379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]